Bahan Ajar Kepemimpinan Pendidikan Kd 322 2 Sks



Keterangan eBook
Title BAHAN AJAR
Author CSS
Creator Microsoft® Office Word 2007
CreationDate 2010-06-04T03:56:14-04:00
ModDate 2010-06-04T03:56:14-04:00
Producer Microsoft® Office Word 2007
Pages 133 Page
Ukuran File 1,130 KB
Dibuka 7 Kali
Topik Contoh Proposal
Tanggal Unggah Friday, 18 Nov 2016 - 09:15 PM
Link Unduh
Baca Halaman Penuh BUKA
Rating eBook
Bagi ke Yang Lain

Kesimpulan

BAHAN AJAR KEPEMIMPINAN PENDIDIKAN KD 322 2 SKS DOSEN/ASISTEN: 1. Dra. Taty Rosmiaty, M.Pd. (1076) 2. Asep Suryana, S.Pd., M.Pd. (2O31) 3. Dr. Nur Aedi, M.Pd. (2286) JURUSAN ADMINISTRASI PENDIDIKAN FAKULTAS ILMU PENDIDIKAN UNIVERSITAS PENDIDIKAN INDONESIA 2009

1 A. Tinjauan Umum Mata Kuliah Visi: Mata Kuliah Kepemimpinan Pendidikan Jurusan Administrasi Pendidikan dapat melahirkan pemimpin-pemimpin dalam bidang pendidikan yang memiliki ahlak dan moral yang baik, serta keterampilan dan kemampuan kepemimpinan yang tinggi. Misi: Mengembangkan keilmuan kepemimpinan dan kepemimpinan pendidikan, Mendidik calon-calon pemimpin dalam bidang pendidikan yang ber-ahlaq, Melahirkan pemimpin pendidikan yang handal. Tujuan Umum Pembelajaran: Mahasiswa dapat memperoleh dan memahami serta menerapkan keilmuan kepemimpinan pendidikan dalam bidang pendidikan secara komprehensip. B. Program Umum Perkuliahan Pertemuan Pokok Bahasan Kompetensi Dasar Indikator 1 Introduction Mahasiswa memahami hakekat mata kuliah Kepemimpinan Pendidikan dan mengikuti mata kuliah dengan baik Mengikuti kuliah dengan baik, memahami aturan main perkuliahan dan siap mengikuti perkuliahan 2 Konsep dasar pemimpin dan kepemimpinan pendidikan. Teori munculnya kepemimpinan. Mahasiswa memahami konsep dasar pemimpin Mahasiswa memahami komsep kepemimpinan dan kepemimpinan dalam pendidikan Mahasiswa memahami teori munculnya kepemimpinan Tahu dan Paham konsep pemimpin dan kepemimpinan, tahu dan paham konsep munculnya pemimpin dan kepemimpinan, paham konsep dan teori kepemimpinan pendidikan. 3 Syarat-syarat kepemimpinan pendidikan Azas Kepemimpinan Pendidikan Mahasiswa memahami syarat-syarat dalam kepemimpinan pendidikan Mahasiswa

2 Pertemuan Pokok Bahasan Kompetensi Dasar Indikator memahami azas/landasan dalam kepemimpinan pendidikan 4 Keterampilan dan kepribadian kepemimpinan pendidikan Fungsi kepemimpinan pendidikan 5 Kewenangan dan kekuasaan dalam kepemimpinan pendidikan 6 Gaya-gaya Kepemimpinan 7 Kepemimpinan dan Perubahan 8 UTS 9 Manajemen Konflik Oleh Pemimpin 10 Value-Based Leadership 11 Situational Leadership 12 Visionary Leadership 13 Transformational leadership 14 Principalships 15 Reviu kuliah 16 UAS

3 C. Program Per-Pertemuan Pertemuan 1 1. Pokok Bahasan; Orientasi perkuliahan, memperkenalkan secara umum jati diri mata kuliah, aturan main dalam perkuliahan, dan sumber-sumber yang dapat dipergunakan dalam mempelajari mata kuliah Kepemimpinan Pendidikan. 2. Kompetensi yang akan dicapai; Setelah menerima materi ini mahasiswa dapat memahami hakekat mata kuliah Kepemimpinan Pendidikan dan mengikuti mata kuliah dengan baik. 3. Petunjuk belajar; Untuk dapat mengikuti dan memahami pertemuan pertama ini maka mahasiswa diharapkan: a. Datang tepat pada waktunya di dalam kelas b. Mendengarkan setiap pembicaraan dosen c. Bertanya apabila ada yang belum dipahami d. Meminta silabus perkuliahan kepada dosen e. Membaca setiap isi silabus dengan seksama f. Membaca buku pedoman akademik untuk memahami secara utuh perturan akademis dalam perkuliahan. 4. Konten atau isi materi pembelajaran; - Penjelasan tentang jati diri mata kuliah: Deskripsi, pentingnya mata kuliah, Visi, Misi dan Tujuan. - Penjelasan tentang pengertian dan metodologi. - Beban belajar: 1) Tatap muka sebanyak 16 kali untuk 2 sks/minggu (2 x 50 menit). Tatap muka ini diisi dengan kegiatan penjelasan konsep, studi lapangan ,analisis hasil studi lapangan (perorangan dan kelompok), konfirmasi dan diskusi umpan balik. 2) Tugas terstruktur dan tugas mandiri. - Evaluasi hasil Belajar, diperoleh dari komponen:

4 1) Ujian Akhir Semester 2) Ujian Tengah Semester 3) Partisipasi studi lapangan dan anlisis 4) Tugas terstruktur dan mandiri - Sumber Belajar 5. Informasi pendukung; Sumber belajar yang dapat dipelajari meliputi buku-buku dan sumber melalui teknologi internet sebegai berikut: - Barnes, Tony, (1998), Kaizen Strategies for Succesful Leadership, (Alih bahasa Martin Widjokongko; Kepemimpinan Sukses, Bagaimana Membawa Organisasi Anda Menuju Masa Depan), Batam : Interaksara. - Bender, Peter, Urs., (2001), Leadership From Within, New York : Niagara Falls. - Cohen, William., A., (2002), The New Art of the Leader, (Alih Bahasa Hendrikus Leko; Seni baru Tentang Pemimpin, Memimpin Dengan Integritas dan Kehormatan), Jakarta : PT. Prenhallindo. - Jacobson, Paul B., et.al., (1977), The principalship: New Perspective, New Jersey: Prentice Hall, Inc. - Katzenbach, Jon, R., (1998), Real Change Leaders, (Alih Bahasa Agus Maulana ; Pemimpin Perubahan Sejati), Jakarta : Professional Books. - Leithwood, K.A. & Meontgomery, D.J., (1986), Improving Principal Effectiveness, The Principal Profile, Toronto: The OISE Press. - Lipham, James, M., (1985), The Principalship; Concepts, Competencies, and Cases, New York & London : Longman. - Malaska P., Holstius K., (1999), Visionary Management, Finland Futures Reserch Centre, http://www.tukkk.fi/futu/FUTU/Tuokset/vision.htm. - Mulayasa, E., (2003), Menjadi Kepala Sekolah Profesional ; Dalam Konteks Menyukseskan MBS dan KBK, Bandung : PT. Remaja Rosdakarya. - Razik, Taher A., (1995), Fundamental Concepts of Educational Leadership and Mangement, New Jersey : Prentice Hall, Inc.

5 - Sapari, Achmad, (2001), Kepala Sekolah yang Ideal, FORUM OTONOMI PENDIDIKAN Kompas CyberMedia, http.\\www.kompas.com\ - Soemanto, Wasti, (1982), Kepemimpinan Dalam Pendidikan, Surabaya : Usaha Nasional. - Sutarto, (1991), Dasar-dasar Kepemimpinan Administrasi, Yogyakarta : Gadjah Mada University Press. - Tim Dosen Adpend, (2001), Pengantar Pengelolaan Pendidikan, Bandung : Jurusan Administrasi Pendidikan FIP UPI. - Turney, C., & N Hatton, K. Laws, K. Sinclair, D. Smith, (1992), The School Leader; Educational Management Roles and Task, Austria : Allen & Unwim. - Wahjosumidjo, (2002), Kepemimpinan Kepala Sekolah; Tinjauan Teoritik dan Permasalahannya, Jakarta : PT. RadjaGrafindo Persada. - West, A.M, (2000), Developing Cretaivity In Organizations; Mengembangkan Kreativitas dalam Organisasi, Yogyakarta : Kanisius. - Ya'qub, Hamjah, (2001), Menuju Keberhasilan Manajemen dan Kepemimpinan, Surabaya : Usaha Nasional. - Yukl, Gary A., (1989), Leadership In Organization, USA : Prentice-all International, Inc. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi 9. Respon atau balikan terhadap hasil evaluasi

6 Pertemuan 2 1. Pokok Bahasan; Konsep dasar pemimpin dan kepemimpinan pendidikan, serta teori munculnya kepemimpinan 2. Kompetensi yang akan dicapai; - Mahasiswa memahami konsep dasar pemimpin - Mahasiswa memahami konsep kepemimpinan dan kepemimpinan dalam pendidikan - Mahasiswa memahami teori munculnya kepemimpinan 3. Petunjuk belajar a. Mulailah dengan basmallah b. Datang tepat pada waktunya di dalam kelas c. Mendengarkan setiap pembicaraan dosen d. Bertanya apabila ada yang belum dipahami e. Meminta silabus perkuliahan kepada dosen f. Membaca setiap isi silabus dengan seksama g. Membaca buku pedoman akademik untuk memahami secara utuh perturan akademis dalam perkuliahan. 4. Konten atau isi materi pembelajaran Kepemimpinan adalah rangkaian kegiatan penataan berupa kemampuan mempengaruhi perilaku orang lain dalam situasi tertentu agar bersedia bekerjasama untuk mencapai tujuan yang ditetapkan. Dalam menjalankan kepemimpinannya, seorang pemimpin memiliki gaya-gaya tersendiri. Gaya (style) adalah suatu cara berperilaku yang khas dari seorang pemimpin terhadap para anggota kelompoknya. Kepemimpinan (leadership) adalah kemampuan yang harus dimiliki oleh seorang pemimpin (leader) tentang bagaimana menjalankan kepemimpinannya (to lead) sehingga bawahan dapat bergerak sesuai dengan yang diinginkan dalam mencapai tujuan yang ditetapkan sebelumnya. Bergeraknya orang-orang harus mengikuti jalur tujuan organisasi yang hendak dicapai dan bukan merupakan

7 kamuplase (kepura-puraan/keinginan pemimpin) dari kepemimpinannya itu sendiri, karena bagaimanapun pemimpin itu adalah bagian dari anggota organisasi itu sendiri. Adapun pergerakan dalam pencapaian tujuan adalah legitimasi dari sebuah kekuasan yang dimiliki oleh pemimpin, karena bagaimanapun bukan hanya sebuah simbol atau kedudukan semata. A Leader adalah seorang yang dipandang memiliki kelebihan dari yang lainnya untuk jangka panjang maupun jangka pendek dengan kewenangan dan kekuasan dalam situasi tertentu. Leading adalah kegiatan dimana individu-individu atau kelompok dipandang oleh satu atau lainnya untuk mengarahkan dalam pencapaian tujuan, walaupun tujuan itu merupakan tujuan individu. Dalam konteks memimpin ini banyak diantaranya anggota dari luar organisasi menjadi orang yang mengarahkan kegiatan orang yang ada dalam organisasi (bias). Leadership adalah proses yang mengarahkan kemampuan dalam pencapaian tujuan dengan memanfaatkan orang-orang atau kelompok dalam kondisi tertentu. Kepemimpinan adalah perilaku dari seseorang ketika dia mengarahkan kegiatan-kegiatan dari kelompoknya ke arah pencapaian tujuan (Hemphill & Coons) Kepemimpinan adalah hubungan kerja antara anggota-anggota kelompok dimana pemimpin memperoleh status melalui partisipasi aktif Dan dengan memperlihatkan kemampuannya untuk melaksanakan tugas kerjasama dengan usaha mencapai tujuan (Stogdill) Kepemimpinan adalah cara interaksi dengan orang-orang lain yang merupakan suatu proses sosial yang mencakup tingkah laku pemimpin yang diangkat (Jenings) Kepemimpinan adalah proses mengarahkan aktivitas kelompok yang terorganisasi ke arah pencapaian tujuan (Rauch & Behling) Untuk lebih jelasnya di bawah terdapat beberapa perbedaan konsepsi dalam melihat teori kepemimpinan : 1. Konsepsi yang luas a) Seseorang yang mempengaruhi anggota-anggota kelompok

8 b) Seseorang yang mempengaruhi anggota-anggota organisasi dalam banyak kegiatan c) Seseorang yang mempengaruhi anggota-anggota kelompok untuk ikut dengan permintaannya dengan rela atau tidak rela 2. Konsepsi yang lebih kecil a) Seseorang yang mengusahakan banyak pengaruh untuk anggota-anggota kelompok lainnya b) Seseorang yang secara sistematis mempengaruhi perilaku anggota untuk pencapaian sebuah tujuan c) Seseorang yang dengan komitmen yang penuh terhadap anggota kelompok dalam mencapai sebuah tujuan. Dilihat dari sisi model pendekatan ada beberapa Model Pendekatan dalam melihat teori Kepemimpinan, yaitu sebagai berikut : 1. Power – Influence Approach 2. Trait Aproach 3. Behavior Approach Power Bases and Usage Effectitiveness Criteria Leader Traits and Skills Effectiveness Criteria Leader Behavior Intervening Variables End Result Variables

9 4. Situational Approach 5. Contingency Models Pemimpin dengan kekuasaan yang luas dan terbatas akan memiliki bobot yang sama berat dari sisi pertanggungjawaban secara batiniah. Adapun perbedaannya akan terlihat dari besarnya tanggungjawab berdasarkan area tanggungjawab atas pekerjaan-pekerjaan yang harus dijalankan. Manager memimpin sebagai boss dari urutan pekerjaaan, hair dari pekerjaan, head dari tim proyek. Leadership kunci dalam mengatur orang dalam mencapai tujuan. Komponen-komponen yang menjadi pegangan seorang pemimpin dalam penggerakan anggota-anggota adalah sebagai berikut : 1. Drive/dorongan, akan menghasilkan inisiatif, dan menimbulkan energi yang tinggi dan hasrat untuk berprestasi; 2. Motivation/motivasi, memiliki kekuatan dan hasrat untuk memimpin dan mendorong pelibatan anggota dalam mewujudkan visi; 3. Integrity/integritas/keutuhan/kejujuran, menimbulkan kepercayaan yang penuh dalam bekerjasama dengan yang lain, dan konsistensi dalam perkataan dan perbuatan; 4. Self Confidence/percaya diri, memperlihatkan nilai kepercayaan dalam melakukan transaksi dengan orang lain; 5. Knowledge/pengetahuan, pemahaman yang penuh tentang organisasi. Leader Traits, Skill, Behavior Situational Variables Effectiveness Criteria Leader Behavior Situational Variables Effectiveness Criteria

10 Pimpinan adalah penggerak sebuah atau beberapa buah kelompok. Untuk dapat mengerakkan kelompok, ada kesepakatan-kesepakatan yang harus dijalin dalam dan dengan kelompok, hal-hal yang harus diperhatikan : 1. Memperhatikan secara jelas dan logis posisi kita, akan membantu orang dalam memahami cara pandang kita; 2. Mendengarkan setiap reaksi orang lain, dan jangan berpura-pura tidak tahu; 3. Libatkan semua dalam diskusi, dan temukan alternatif-alternatif tentang cara pandang kita; 4. Jangan berubah pikiran hanya untuk meredam konflik, tapi temukan yang terbaik, dan dalam posisi yang logis; 5. Usahakan jangan dulu melakukan pemungutan suara, melempar koin, atau menyerah, untuk memecahkan perbedaan, cobalah dengan argumen-argumen yang benar; 6. Jangan terlalu terpaku dengan pemilihan situasi win-lose. Kekuasaan pimpinan dalam konteks personal power itu tidak akan berarti untuk dapat menjelaskan bahwa kepemimpinan yang dijalankan efektif dalam mempengaruhi orang lain. Personal behavior pimpinan dan keterampilan yang dijalankan efektif dalam mempengaruhi harus terangkum didalamnya bila kita menginginkan kelanjutan bagaimana pimpinan mempengaruhi orang lain. Kekuasaan personal dari pimpinan sangat bergantung kepada kemampuan /keterampilan dari pimpinan. Perilaku pimpinan dalam pengaruh, mengarahkan pada cara yang digunakan dalam pengaruh. Model Pengaruh dalam Kekuasaan dan Kepemimpinan (Diadopsi dari Gery Yukl : 1989) Expertise Pimpinan & Keterampilan dalam Pengaruh Perilaku pimpinan Taktik/Cara Mempengaruhi Kekuasaan Personal Posisi Kekuasaan Variabel Intervening - Terpenuhi - Komitmen - Perlawanan Variabel hasil akhir - Sukses kelompok - Kelompok gagal

11 Adapun untuk meningkatkan efektivitas dalam kepemimpinanya, pemimpin dapat menggunakan taktik/cara dalam pengaruh : 1) Rational Persuasion (bujukan secara rasional), menggunakan argumen-argumen yang logis dan data-data faktual untuk membujuk orang-orang, dimana permintaan-permintaan yang diajukan dapat berjalan dan menghasilkan keluaran-keluaran yang diharapkan; 2) Exchange Tactics (taktik pertukaran), permintaan/proposal yang diajukan berupa janji yang secara eksplisit atau implisit menyediakan hadiah pada orang-orang yang menjadi target. 3) Legitimate Request (permintaan yang legitimate), basis dari permintaan dengan menggunakan fasilitas kewenangan atau aturan-aturan, dan disesuaikan dengan peraturan-peraturan organisasi, kebijakan, dan kegiatan-kegiatan yang dijalankan. 4) Pressure Tactics (taktik tekanan), melalui perlakuan yang secara eksplisit atau implisit memuat ketentuan bahwa kesalahan yang terjadi memiliki konsekuensi-konsekuensi tertentu. 5) Personal Eppeals (daya tarik personal), menggunakan sisi hati orang lain dan perkawanan secara personal berbagai basis dari permintaan-permintaan. Dalam pendekatan keperilakuan (traits/behavioral approach) mencoba mengidentifikasi perilaku yang khas dari pemimpin dalam kegiatannya untuk mempengaruhi anggota-anggota kelompok atau pengikutnya. Perilaku pemimpin ini dapat berorientasi pada tugas keorganisasian ataupun pada hubungan dengan anggota kelompoknya. Untuk tujuan pemahaman dan peningkatan profesional pemimpin dalam pekerjaan perlu dipahami dan dikuasai keterampilan dalam : (1) melibatkan anggota dalam pengambilan keputusan, (2) mendelegasikan kewenangan, (3) membuka jalur-jalur komunikasi, (4) pengembangan Sumber Daya Manusia (perhatian pada pola hubungan antar manusia), (5) konsentrasi pada mutu. Sebagai manager sekolah setelah keterampilan-keterampilan itu dikuasai, hal ini perlu diaplikasikan dalam kegiatan-kegiatan: (1) menetapkan visi dan formulasi misi dari sekolah, (2) menetapkan kebijakan dan tujuan yang hendak

12 dicapai, (3) melakukan kegiatan penyusunan program, (4) memperkirakan dan mengalokasikan sumber daya, (5) memodifikasi kebijakan dan perencanaan. Kepala sekolah akan berhasil dalam mengelola sekolah yang dipimpinnya bila keterampilan-keterampilan itu harus melekat dalam hal-hal berikut ini; 1) Keterampilan dalam Kepemimpinan; 2) Keterampilan dalam Hubungan Antara Manusia; 3) Keterampilan dalam Kegiatan Kelompok; 4) Keterampilan dalam Administrasi Personil; 5) Keterampilan dalam Penilaian dan Pengawasan (Evaluasi). Dalam kerangka pengembangan mutu sekolah yang pengelolaannya berbasis TQM (Total Quality Management), sangat jelas bahwa tipe kepemimpinan yang memiliki visi kedepan dengan memberdayakan orang lain, berpenampilan unggul dan memiliki strategi yang tinggi dalam memenuhi kegiatan kastemernya. Oleh karena itu kepemimpinan yang bermutu tidak hanya berketerampilan yang tinggi saja akan tetapi juga harus memiliki kriteria lainnya seperti visi, strategi dalam berupaya untuk memenuhi keinginan pelanggannya dengan baik. Hal ini sejalan dengan pemikiran dari Eva Balazs (1999): “Leadership in the TQM context is visionary in that is embraces empowerment, perpormance and strategy, means; Have a vision of total quality management for his or her institution. Have a clear commitment to the quality improvement process. Communicate the quality message. Ensure that customer needs are the centre of the institution’s policies and practise. Ensure that there are adequate channels for the voice of customers. Lead staff development. Be carefull not blaming others when problem arise – most problems are the result of polycies of the institution and the failling of the staff. Lead inovatian within the institution. Ensure than organizational structures clearly define responsibilities and provide the maximum delegation compatible whit accountability. Tergambarkan dengan jelas bahwa kepemimpinan dalam konteks TQM harus memiliki kekuatan-kekuatan dalam visi yang beranjak dari TQM untuk organisasi yang dipimpinnya, memiliki komitmen yang jelas dalam proses

13 pengembangan mutu organisasi, membangun pola-pola komunikasi yang beragam dalam mengkomunikasikan setiap pesan-pesan dalam peningkatan mutu kelembagaan, kebijakan dan langkah-langkah kegiatan dalam organisasi tidak terlepas dari kebutuhan-kebutuhan para kastemer organisasi baik pada tatanan internal maupun eksternal, menyediakan saluran bagi kastemer dalam memperkuat kualitas yang diraih, memimpin dalam pengembangan staf, tidak menyalahkan orang lain dalam menyikapi permasalahan, memiliki sikap dalam menyikapi permasalahan karena biasanya permasalahan itu mungkin berasal dari kebijakan yang dibuat, memimpin inovasi dalam organisasi, mendelegasikan kewenangan dengan sejumlah tanggungjawab kepada bawahan. Peranan Pemimpin dalam Organisasi : - Membantu menciptakan iklim sosial yang baik - Mwmbantu kelompok untuk mengorganisasikan diri - Membantu kelompok dalam menetapkan prosedur kerja - Mengambil tanggungjawab untuk menetapkan keputusan bersama dengan kelompok - Memberi kesempatan pada kelompok untuk belajar dari pengalaman Bagaimana Seharusnya Pemimpin Memilih Strategi? a. Beberapa hasil penelitian mengatakan bahwa pemimpin harus menerapkan beberapa strategi dalam kepemimpinannya. b. Robert Starratt, 1995; kepala sekolah sebagai pemimpin harus menggunakan dua buah topi ----- sebagai pemimpin Dan sebagai administrator. c. Beberapa hal yang harus diperhatikan oleh pemimpin dalam menjalankan kepemimpinannya, yaitu : - Pemimpin harus menggunakan strategi yang fleksibel. - Pemimpin harus menjaga keseimbangan dalam menentukan kebutuhan jangka panjang Dan jangka pendek. - Pemilihan strategi harus yang memberikan layanan terhadap lembaga - Kegiatan yang sama dapat digunakan untuk beberapa aksi dalam strategi.

14 Sebuah Gabungan Model Efektivitas Perilaku Manajerial 1. Infuencing People; a) Recognizing & Rewarding, b) Motivating 2. Making Decision ; a) Consuting and Delegating, b) Planning & Organizing, c) Problem Solving 3. Giving – Seeking Information ; a) Monitoring, b) Clarifying, c) Informing 4. Building Relationship ; a) Managing Conflict & Team Building, b) Networking, c) Supporting 5. Informasi pendukung Untuk menambah pengetahuan selain buku-buku yang dikemukakan pada pertemuan ke satu juga mahasiswa dapat mengakses jurnal-jurnal di internet seperti The Journal Leadership Of Education pada www.JVBL.com, lainnya; 1) SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership, and Change. htm. 2) SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 3) SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan Coba anda jelaskan munculnya kepemimpinan dengan menggunakan pendekatan;1) power, 2) treath, 3) behavioral, 4) situational, dan 5) contingncy. A B A B C A B C A B 1 2 3 4 C

15 7. Lembar Kerja (LK) Setelah membaca dan menjawab soal latihan buat rangkuman dengan bahasa untuk materi diatas untuk mempermudah mempersiapkan diri ketika ujian tengah atau akhir semester. 8. Evaluasi Jawablah pertanyaan-pertanyaan di bawah ini dengan membubuhkan tanda silang (x) pada jawaban yang dianggap benar. 1) Salah satu kritik terhadap pendekatan sifat kepribadian pemimpin adalah : Setiap manusia memiliki kepribadian yang berbeda; Sifat-sifat yang dituntut bagi seorang pemimpin bertentangan satu dengan lainnya; Tidak ada manusia yang memiliki kepribadian lengkap bagi seorang pemimpin; Kepribadian manusia selalu berubah-ubah. 2) Menurut pendekatan sifat kepribadian pemimpin, pendidikan tidak mampu membentuk seorang pemimpin sebab : Manusia dilahirkan dengan kepribadian yang unik; Kepribadian bersifat tidak dapat dirubah; Pendidikan hanya memberikan teori kepemimpinan; Kepemimpinan menuntut sifat kepribadian tertentu. 3) Menurut Siagian pemimpin yang berhasil adalah seseorang yang : Dilahirkan dengan bakat-bakat kepemimpinan; Memperoleh kesempatan mengembangkan bakat kepemimpinannya melalui pendidikan; Memiliki pengalaman kerja; Dilahirkan dengan bakat-bakat kepemimpinannya melalui pendidikan serta memiliki pengalaman kerja. 4) Dikatakan bahwa satu-satunya hal yang konstan di dunia ini adalah perubahan. Kondisi ini menuntut seorang pemimpin untuk memiliki sifat kepribadian : Pendidikan umum yang luas; Kemampuan berkembang secara mental; Ingin tahu; Kemampuan analisis. 5) Adanya fungsi-fungsi yang berbeda, spesialisasi yang semakin beraneka ragam dan kepentingan yang beraneka ragam menunjukan pentingnnya sifat kepribadian : Daya ingat yang kuat; c. Keterampilan berkomunikasi; Kapasitas integrafik; d. Keterampilan mendidik. 6) Sifat kepribadian rasionalitas dan objektivitas diartikan bahwa seorang pemimpin : Tidak boleh dikuasai oleh emosi; Mampu membuat keputusan yang dapat dilaksanakan oleh para pelaksana; Dapat menentukan urutan permasalahan berdasarkan kepentingannya (Ambeg Parama Arta); Mampu memilih saat yang tepat untuk bertindak. 7) Sifat yang menunjang untuk terciaptanya hubungan yang akrab antara pemimpin dengan yang dipimpin adalah sifat kepribadian : Sense of Cohesiveness; Sense of Relevance; Kesederhanaan;

16 Adaptabilitas dan fleksibilitas. 8) Pendekatan keperilakuan berorientasi pada dua hal yaitu : Tugas keorganisasian dan hubungan dengan anggota kelompoknya; Fungsi kepemimpinan dan gaya kepemimpinan; Tugas keorganisasian dan gaya kepemimpinan; Fungsi kepemimpinan dan hubungan dengan anggota kelompoknya. 9) Yang dimaksud dengan gaya kepemimpinan adalah : Cara pemimpin berperilaku yang dikaitkan dengan situasi yang dihadapi; Cara pemimpin berperilaku yang dikaitkan dengan tujuan kegiatan; Cara pemimpin berperilaku yang dikaitkan dengan para anggota kelompoknya; Cara pemimpin berperilaku yang dikaitkan dengan lingkungan kerjanya. 10) Perilaku struktur atau initiating structure menunjuk pada perlunya : Saling mempercayai, kehangatan, dan saluran-saluran komunikasi; Hubungan bersahabat, saluran-saluran komunikasi, dan cara mengerjakan pekerjaan; Cara mengerjakan pekerjaan, respek dalam berinteraksi, dan kehangatan Saluran-saluran komunikasi, cara mengerjakan pekerjaan, pola-pola organisasi. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 10, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

17 Pertemuan 3 1. Pokok Bahasan; Syarat dan azas dalam Kepemimpinan Pendidikan 2. Kompetensi yang akan dicapai; - Mahasiswa memahami syarat-syarat dalam kepemimpinan pendidikan - Mahasiswa memahami azas/landasan dalam kepemimpinan pendidikan 3. Petunjuk belajar; - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran; Fungsi kepemimpinan merupakan salah satu fungsi dalam manajemen yang tidak bisa terpisahkan. Kepemimpinan tidak hanya sekedar memerintah, menghukum, dan menyuruh, akan tetapi lebih dari itu kepemimpinan adalah seni dalam memerankan seorang pemimpin yang dapat melaksanakan transformasi kebijakan menjadi sebuah bentuk operasional, sehingga bentuk-bentuk perintah dan pengarahan dapat dimengerti dan dijalankan oleh bawahan. Pimpinan harus memiliki kemampuan melihat jauh kedepan (visioner) dan mampu mengkomunikasikan visi, misi atau strategi serta nilai-nilai kepada semua orang yang terlibat dan terkait dalam pencapaiannya. Kepemimpinan yang kreatif adalah bagaimana mengelola organisasi menjadi kreatif yang dapat tumbuh dengan cepat tanpa kehilangan fokus, melupakan misi, mengalihkan pandangan dari batas-batas kemampuannya. Pemimpin kreatif tidak menjadi puas diri, terlalu percaya diri, arogan, malas dan resah. Bagaimana dapat terus tumbuh dan dapat menghindari lubang-lubang

18 permasalahan tersebut. Michael Esimer (2002), kepemimpinan kreatif itu ditandai dengan hal-hal berikut ini: 1) Pusatkan pandangan Anda pada bolanya; 2) Ingatlah satu-satunya cara untuk berhasil dengan kreatif adalah dengan gagal; 3) Memiliki suatu organisasi yang dapat mengikuti dan melaksanakan gagasan dengan baik; 4) Sinergi dapat menjadi satu-satunya koordinasi terpenting bagi laba dan pertumbuhan dalam suatu perusahaan kreatif; 5) Peremajaan adalah kunci lain pertumbuhan dan bertahan hidup dengan memindahkan para eksekutif anda yang paling cemerlang pada tanggungjawab yang baru sesering mungkin. Kepemimpinan yang kreatif dicirikan dengan kemampuan inspirasional, dimana mampu memberikan peluang kepada semua anggota untuk mengeluarkan ide-ide, gagasan-gagasan baru dalam melaksanakan pekerjaan dan mampu serta berani mengambil resiko terkecil apapun dalam perhitungan-perhitungan yang tepat. Dalam konteks transformasional seperti dikemukakan oleh Triguna Priyadharma (2001) : Seni kepemimpinan mampu dengan tepat memilih kapan berbuat trasformasional dan kapan mereka dapat transaksional meliputi: (1) pandangan ke depan, inspirasi; (2) rencana jangka panjang; (3) praktis, konkrit, nyata; (4) pasif; (5) menjaga stabilitas; (6) menjelaskan. Kreativitas seorang pemimpin berarti kemampuan pemimpin dalam berfikir, berdaya cipta dan melakukan kreasi-kreasi baru menyongsong hari yang lebih baik, meraih keuntungannya dan keberhasilan yang diharapkan. Kreativitas seorang pemimpin berarti mengalirkan gagasan baru dan produktif untuk segera diterapkan dalam bentuk nyata. Manajemen pendidikan kita mengalami perubahan, dari pengelolaan yang sentralistik menjadi otonomi penuh kepada sekolah sesuai dengan potensinya masing-masing. Dalam masa-masa transisi seperti ini, maka kepala sekolah adalah seseorang yang memiliki kreativitas dalam mentransformasikan perubahan yang bukan tidak mungkin sudah merupakan budaya bagi organisasi sekolah. Gambar berikut ini, memberikan gambaran tentang seorang pimpinan yang

19 transformasional dalam bentuk kegiatan-kegiatan yang harus dijalankannya sebagai bentuk fungsi dan tanggungjawabnya; Kepemimpinan Transformasional (A. Dale Timpe : 1987) Kepala Sekolah yang kreatif dalam konteks transformasional memiliki ciri-ciri karakter sebagai berikut : cenderung mengamati situasi dan problema yang tidak diperhatikan sebelumnya, menghubung-hubungkan ide-ide dan pengalaman yang diperolehnya, cenderung menampilkan beberapa alternatif terhadap subjek tertentu, dan tidak menerima begitu saja hal-hal yang belum terjadi dan tidak terkait dengan kebiasaan, memanfaatkan potensi pribadi, mengusahakan fleksibilitas tinggi dalam bidang pemikiran, dan pandai menghargai waktu dan memanfaatkannya sebaik mungkin untuk menciptakan sesuatu. Pendapat lain mengatakan bahwa kreativitas kepala sekolah SLTP ditandai dengan: (Depdiknas : 2002) 1) Memilki dan melaksanakan kreativitas dan inovasi; 2) Memiliki dan menghayati arti dan tujuan perubahan (inovasi); 3) Menggunakan metode, teknik, dan proses perubahan sekolah; 4) Menumbuhkan iklim yang mendorong kebebasan berfikir untuk menciptakan kreativitas dan inovasi; 5) Mendorong warga sekolah untuk melakukan eksperimentasi, prakarsa/keberanian moral untuk melakukan hal-hal baru; 6) Menghargai hasil-hasil kreativitas warga sekolah dengan memberikan rewards yang menumbuhkan jiwa kewirausahaan warga sekolah. Melepaskan Diri Tdk Mengidentifikasikan diri Kekecewaan, tdk berorientasi Proses Kematian & Kelahiran Kembali Kehancuran & Menggabungkan kembali Pndangan mengenai akhir keadaan & permulaan baru Menemukan penjajaran diri & melepas tenaga baru Skenario baru Berpindah melewati zona netral Permulaan Baru Zona Netral dari keadaan Transisi M E M I C U K E J A D I A N Kebutuhan yg dirasakan Kekuatan Perlawanan Tidak ada perubahan Penciptaan Bayangan Memobilisasi Komitmen Melembagakan Perubahan Kepemimpinan Transformasional Kepemimpinan Transaksional Dinamika Organisasi Dinamika Individu Akhir Keadaan

20 Hanya perlu diperhatikan untuk menjadi kreatif itu ada banyak hambatan; diantaranya berkaitan dengan sifat tidak percaya pada kemampuan yang dimiliki, sikap takut terhadap kegagalan dan kritik, sikap ingin seperti orang lain, dan dapat berkonsentrasi, ada sikap-sikap yang diharapkan memberikan pandangan berfikiran kolot, dan lingkungan yang memanjakan sehingga melemahkan kreativitas. Akan tetapi untuk menjadi seorang kepala sekolah yang kreatif itu sangat mudah, diantaranya harus memahami hal-hal berikut yang dikemukakan oleh Achmad Sapari (2001) ; Pertama, kepala sekolah yang demokratis, yaitu kepala sekolah yang mau memahami keberadaan guru, baik segi kelebihannya maupun kelemahannya. Kepala sekolah jenis ini juga memberikan kesempatan seluas-luasnya kepada guru untuk mengelola kelas dan keuangan yang menjadi tanggung jawabnya. Kepala sekolah yang demokratis selalu menerima masukan dari guru dan secara terus-menerus memberikan bimbingan yang efektif. Kepala sekolah yang demokratis akan memberikan kesempatan kepada guru untuk lebih kreatif. Ia akan senang apabila banyak guru yang dibinanya meningkat pengetahuan dan kreativitasnya. Tidak pernah sekalipun kepala sekolah yang demokratis menghambat setiap kemajuan yang tampak dalam diri guru yang menjadi mitra pengetahuan dan kreativitasnya. Tidak pernah sekalipun kepala sekolah yang demokratis menghambat setiap kemajuan yang tampak dalam diri guru yang menjadi mitra kerjanya. Kedua, Kepala sekolah yang kreatif dan imajinatif. Kepala sekolah jenis ini memiliki kreativitas yang tinggi untuk kemajuan sekolahnya. Daya imajinasinya yang kuat juga melahirkan pemikiran-pemikiran yang khas. Mungkin, pada tahap awal, gagasannya akan dinilai kontroversial. Akan tetapi, ketika gagasan itu dilaksanakan, maka akan menjadi sebuah pola yang menarik dan diikuti oleh banyak kepala sekolah lainnya. Kepala sekolah yang kreatif akan memenuhi kriteria kreativitas yang menyangkut tiga dimensi, yaitu dimensi proses, person, dan produk kreatif

21 (Amabile,1983). Dengan menggunakan proses kreatif sebagai kriteria kreativitas, maka segala produk yang dihasilkan dari proses itu dianggap sebagai produk kreatif dan kepala sekolahnya disebut kepala sekolah kreatif. Hal ini dilukiskan oleh Koestler (1964: 119) yang mengartikan kreativitas itu sebagai suatu proses bisosiatif, yaitu the deliberate connecting of two previously unrelated matrices of thought to produce a new insight or invention. Ketiga, kepala sekolah yang mampu menjadi teladan, baik secara moral maupun profesional. Secara moral artinya perilaku kepala sekolah benar-benar menjadi teladan, baik bagi guru, siswa, maupun masyarakatnya. Secara profesional, kepala sekolah harus mampu membuktikan bahwa dalam bekerja ia tidak hanya didasarkan pada intuisi, melainkan pada patokan-patokan ilmiah yang jelas. Dengan demikian, sasaran yang hendak dicapai pun sesuai dengan kriteria profesional. Dalam kerangka pencapaian mutu sekolah yang dipimpinnya, maka kepala sekolah yang berorientasi kepada mutu sangat menjadi vital perananya. Karena bagaimanapun sekolah yang bermutu akan tergambarkan oleh bentuk–bentuk peranan kepala sekolah dalam pencapaiannya. Seperti yang telah dikemukakan oleh Sallis (1993), What is the role the leader in an institution under taking a total quality initative? : Have a vision of total quality for his or her institution; Have commitment to the quanty improvement process; Communicate the quality massage; Ensure that there are adequate channels for the voice of customers; Lead staff development; Be careful not to blame others when problems arise without looking at the avidence; Lead inovation within their institution; Ensure that organizational structures clearly define responsibilities and provide the maximum delegation compitible with occountability; Be commited to the removal of artificial barries whether they be organizational or culture; Build effective teams; Develop appropriate mechanisems for monitoring and evluating success.

22 Komitmen dalam pelaksanaan kegiatan-kegiatan yang menjadi tanggungjawabnya adalah basis dari self-efficacy yang harus diperhatikan oleh kepala sekolah. Hal ini memberikan peluang kepada seluruh staf untuk mengikut i dan melaksanakan setiap gerak dan langkah dari kepala sekolahnya. Guru-guru merasa aman dan nyaman dalam pekerjaanya ketika visi sekolah dapat mengadopsi setiap tujuan yang hendak dicapainya dalam pembelajaran. Semua yang dilakukannya bermuara pada resiko yang harus diambilnya, sehingga apapun yang terjadi setiap pengambilan keputusan mencerminkan pada orientasi kepemimpinannya. Resiko yang ditanggungnya akan lebih mudah ketika komunikasi yang dibangun dengan guru dan staf serta murid-murid sekolahnya baik dan benar. Engkoswara (1999) menggambarkan “….pemimpin-pemimpin yang menampilkan budaya adalah mulia-moral-spiritual yang mantap, semangat bekerja dan berusaha yang ulet yang dilandasi pendayagunaan ilmu pengetahuan, teknologi dan seni tepat guna sejalan dengan etika profesi dalam berbagai bidang, dan kreatif terpuji yang menyenangkan dan menyejukkan setiap insan sehingga menjadi kepercayaan, panutan dan toladan….”. Hal ini sejalan dengan pemikiran dari Jack Hradesky (1995), tantangan-tantangan dalam kepemimpinan kepala sekolah menjadi ringan dan setiap pekerjaan yang dilakukannya menjadi tanggungjawab tim bila kepala sekolah memiliki: Vision ; the ability to see and in mind or goal in complete form; Confidence ; knowing the you and your teak can accompusn assign; Risk taking ; the willingness to try new method Decision making ; Develompment others ; the ability to create leadership thought and action in your teams, spreading responsibility and credit for work; Influence of athers; Communication; the ability to channel your ideas into action. TIPEGAYACARA BERPERILAKU YG KHASSIFAT-SIFAT & CARA-CARA MELAKSANAKAN SERTA MENGEMBANGKAN KEGIATAN KEPEMIMPINANKECENDERUNGANAZAS/DASAR : MENJIWAI SESEORANG DALAM KEPEMIMPINANNYAAZAS LANDASAN YG MEMBAWA IDEOLOGIPRINSIP MEMBERIKAN PEDOMAN DALAM OPERASIONALSIFAT KEPRIBADIAN : PEMBAWAAN/LINGKUNGAN TIPE/MACAM KEPEMIMPINAN :TIPE/MACAM KEPEMIMPINAN :OTORITER DEMOKRATISPSEUDO DEMOKRATISLAISSEZ FAIREMILITERISTIKPATERNALISTIKKI HAJAR DEWANTARAING NGARSO SUNG TULODOING MADYO MANGUN KARSOTUT WURI HANDAYANIDIDEPAN SEBAGAI PEMIMPINCONTOH/TELADAN & PETUNJUKSESUAI DENGAN NORMA-NORMA YG BERLAKUOTORITERDITENGAH MEMBINA KEHENDAKBEKERJASAMAMEMBANTU & MENDORONG PERKEMBANGAN ANGGOTAMEMBANGKITAKN BAWAHAN UNTUK BERKREASIKOOPERATIFDIBELAKANG MENGIKUTI SAMBIL MENDIDIKMENYERAHKAN TANGGUNGJAWABBAWAHAN MEMPERLIHATKAN KEMAMPUAN & INISIATIFWASPADA & SIAP TURUN TANGANDEMOKRASI

23 5. Informasi pendukung - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi 1) Berdasarkan hasil studi Ohio State University, kombinasi perilaku kepemimpinan yang paling efektif akan tercapai apabila terjadi kombinasi antara : a. Struktur inisiasi yang rendah dengan konsiderasi yang tinggi; b. Struktur inisiasi yang tinggi dengan konsiderasi yang tinggi; c. Struktur inisiasi yang rendah dengan konsiderasi yang rendah; d. Struktur inisiasi yang tinggi dengan konsiderasi yang rendah. 2) Berdasarkan teori Managerial Grid, gaya kepemimpinan yang sangat menekankan pada hubungan antar individu tetapi tidak memperdulikan sama sekali produktivitas di sebut gaya kepemimpinan : a. Team; c. Country Club; b. Impoverished; d. Task. 3) Teori kepemimpinan yang menggambarkan tipe kepemimpinan otoriter adalah gaya kepemimpinan : a. Team; c. Country Club; b. Impoverished; d. Task. Pemimpin PendidikanPemimpin PendidikanSYARATSYARAT--SYARATSYARATRENDAH HATI & SEDERHANARENDAH HATI & SEDERHANABERSIFAT SUKA MENOLONGBERSIFAT SUKA MENOLONGSABAR & MEMILIKI KESTABILAN SABAR & MEMILIKI KESTABILAN EMOSIEMOSIPERCAYA KEPADA DIRI SENDIRIPERCAYA KEPADA DIRI SENDIRIJUJUR, ADIL, & DAPAT DIPERCAYAJUJUR, ADIL, & DAPAT DIPERCAYAKEAHLIAN DALAM JABATANKEAHLIAN DALAM JABATANSYARAT SIFAT KEPRIBADIANSYARAT SIFAT KEPRIBADIANPENDIDIKAN UMUM YG MELUAS,PENDIDIKAN UMUM YG MELUAS,KEMAMPUAN BERKEMBANG SECARA KEMAMPUAN BERKEMBANG SECARA MENTALMENTALINGIN TAHUINGIN TAHUKEMAMPUAN ANALITISKEMAMPUAN ANALITISMEMILIKI DAYA INGAT YG KUATMEMILIKI DAYA INGAT YG KUATKAPASITAS INTEGRATIFKAPASITAS INTEGRATIFKETERAMPILAN BERKOMUNIKASIKETERAMPILAN BERKOMUNIKASIKETERAMPILAN MENDIDIKKETERAMPILAN MENDIDIKRASIONALITAS & OBJEKTIVITASRASIONALITAS & OBJEKTIVITASPRAGMATISMEPRAGMATISMEADANYA NALURI UNTUK PRIORITASADANYA NALURI UNTUK PRIORITASSENSE OF URGENCYSENSE OF URGENCYSENSE OF TIMINGSENSE OF TIMINGSENSE OF COHESIVENESSSENSE OF COHESIVENESSSENSE OF RELEVANCESENSE OF RELEVANCEKESEDERHANAANKESEDERHANAANKEBERANIANKEBERANIANKEMAUAN MENDENGARKEMAUAN MENDENGARADAPTABILITAS & FLEKSIBILITASADAPTABILITAS & FLEKSIBILITASKETEGASANKETEGASAN

24 4) Teori kepemimpinan berdasarkan dinamika kelompok mengemukakan bahwa tujuan kelompok dapat digolongkan menjadi dua katagori yaitu : a. Pencapaian tujuan dan integritas kelompok; b. Pencapaian tujuan dan pemanfaatan kelompok; c. Penetapan tujuan dan integritas kelompok; d. Penetapan tujuan dan integritas kelompok. 5) Jika seorang pemimpin telah memberi kepercayaan kepada bawahan (meskipun tidak sepenuhnya), membuka kesempatan bagi bawahan untuk berpartisipasi, melibatkan bawahan untuk turut serta mengambil keputusan yang begitu penting, dan membuka kesempatan kepada bawahan (meskipun masih ada pembatasan), menurut Rensis Likert, pemimpin tersebut melaksanakan sistem kepemimpinan : a. Exploitive Authoritative; c. Consultative; b. Benevolent Authoritative; d. Partisipative. 6) Menurut teori Likert, sistem kepemimpinan yang paling ideal adalah : a. Exploitive Authoritative; c. Consultative; b. Benevolent Authoritative; d. Partisipative. 7) Teori dari Tannembaun dan Schmidt bertolak dari konsep demokratis dan otoriter. Dalam kaitan ini Tannembaun dan Schmidt mengemukakan bahwa seorang pemimpin : a. Hanya dapat mengambil salah satu konsep demokratis atau otoriter; b. Dapat mengambil kedua konsep tersebut dengan derajat sama tinggi; c. Dapat mengambil kedua konsep tersebut secara komplementer; d. Dapat mengambil kedua konsep tersebut tergantung pada situasi. 8) Untuk memilih gaya kepemimpinan yang paling efektif Tannembaun dan Schmidt menyerahkan tiga untuk dipertimbangkan yaitu : a. Kekuatan diri pemimpin, kekuatan bawahan, dan situasi; b. Kekuatan diri pemimpin, kekuatan bawahan, dan tujuan; c. Kekuatan pemimpin, situasi, dan tujuan; d. Kekuatan bawahan, situasi, dan tujuan. 9) Gaya kepemimpinan kolaboratif menurut Rita Dunn dan Kenenth Dunn adalah gaya kepemimpinan yang baru : a. Menunjuk adanya keakraban antara pemimpin dengan anggota kelompok; b. Adanya pembagian kepemimpinan kepada staf; c. Memberi kesempatan kepada staf untuk memberikan saran atau ide; d. Mempunyai sedikit ruang gerak bagi staf untuk berperan serta. 10) Getzel dan Guba mengemukakan dua gaya kepemimpinan, yaitu : a. Normatif dan partisipatif; c. Partisipatif dan personal; b. Normatif dan personal ; d. Partisipatif dan birokratis. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda:

25 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang Pertemuan 4 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar a. Mulailah dengan basmallah b. Datang tepat pada waktunya di dalam kelas c. Mendengarkan setiap pembicaraan dosen d. Bertanya apabila ada yang belum dipahami e. Meminta silabus perkuliahan kepada dosen f. Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran As the research and prectice have shown, leaders bring about change by : developing and articulating a vision of improvement. Planning and providing resources and needed organizational arrangements. Designing and delivering training and ongoing staff development. Monitoring progress and needs. Providing consultation and reinforcement, coaching, and problem-solving. (www. SEDL-Issues about Change Leadership An Imperative for Succesful Change.httm, 1991: 9) Although the principal is the key school leader, it is advantageous to increase leadership density by involving as many personnel as possible in leadership function. Such an approach can reduce the burden on the principal in

26 some areas while providing other personnel with a sense of purposes and commitment to the school’s mission and goals. (C. Turney, N Hatton, K. Laws, K. Sinclair, D. Smith, 1992 : 50, The School Leader ; Educational Management Roles and Task, Allen & Unwim, Australia.) Kita harus mengenal sumber-sumber ide/kreativitas agar dapat diolah menjadi suatu produk inovasi baru dalam memanajemeni bisnis dan kehidupan yang tak menentu ini, antara lain sumber-sumber tersebut: 1) sesuatu yang tidak diperkirakan sebelumnya, 2) kesenjangan antara harapan dan kenyataan, 3) kebutuhan untuk melakukan tugas secara lebuh baik, 4) pergeseran persepsi, tata nilai, aspirasi masyarakat, 5) perubahan dalam kependudukan, 6) perubahan permintaan masyarakat, 7) informasi dan teknologi baru. Kreativitas itu mempunyai insur-unsur penggerak yang bersumber dari energi dalam diri kita sendiri yang jumlahnya tak terbatas. Kita wajib mengenalnya agar p[otensi besar tersebut dapat digali untuk kita manfaatkan secara optimal untuk memecahkan berbagai macam masalah yang selalu kita hadapi. (Agus Darma, 1985 : 9,17, Manajemen Prestasi Kerja; Pedoman Praktis bagi Para Penyelia Untuk Meningkatkan Prestasi Kerja, Rajawli Pers, Jakarta) …tujuan utama supervisi adalah untuk memperoleh komitmen bagi keikutsertaan atau keterlibatan dalam apa-apa yang telah dibicarakan. Bila komitmen tidak mungkin diperoleh atau tidak diperlukan, laing tidak anda menginginkan perstujuan tentang hal-hal yang telah dibicarakan. Persetujuan dan komitmen dapat dibangun melalui penggunaan taktik-taktik berikut : a) ringkasan dan ulangi apa-apa yang telah dibicarakan, b) minta keikutsertaan, c) dengarkan sungguh-sungguh pada saat yang lain telah dikemukakan, d) mintakan pengertian seseorang tentang hal yang telah dikemukakan, e) mintakan persetujuan atau komitmen secara langsung, f) tindak lanjut. (Agus Darma, 1985 : 13, Manajemen Prestasi Kerja; Pedoman Praktis bagi Para Penyelia Untuk Meningkatkan Prestasi Kerja, Rajawli Pers, Jakarta) Komitmen, yaitu suatu niat yang sungguh-sungguh untuk melaksanakan tugas dan kewajiban, janji atau ucapan, tnapa komitmen mengandung sifat

27 kebohongan yang berakibat menurunkan kepercayan orang lain. (Triguna Priyadarma, 2001 : 53, Kreativitas dan Strategi, PT. Golden Trayon Pers, Jakarta) …..kewenangan pimpinan sebagai sumber kekuatan kelompok. Seorang manager yang bertugas memimpin suatu kelompok, untuk mengambil keputusan, atau memecahkan masalah secara efektif, perlu memiliki kemahiran menggunakan kekuasaan atau kewenangan yang melekat pada jabatan manajerialnya sedemikian rupa sehingga kekuasaan atau kewenangan itu mendorong cara berfikir yang kreatif di kalangan para anggota kelompok, dan tidak menjaid momok bagi mereka…….sebaliknya, apabila seorang manajer tidak mampu memanfaatkan kekuasaan atau kewenangannya untuk menggerakan kelompok untuk bekerja secara efektif, hal itu ,merupakan kelemahan yang dampaknya akan dirasakan oleh kelompok yang bersangkutan, termasuk ketidakmampuan manajer tersebut untuk menghilangkan atau menghindari situasi konflik dalam kelompok bersangkutan. ( Sondang P. Siagian, 1992 : 154 -155, Teori dan Praktek Pengambilan Keputusan, CV Haji Masagung, Jakarta) 1) Keterampilan dalam Komunikasi Gaya kepemimpinan terutama berhubungan dengan perilaku komunikatif yang digunakan untuk membantu orang lain untuk mencapai hasil yang diinginkan (R. Wayne Pace, Don F. Faules, 1993 : 303, Komunikasi Organisasi; Strategi Meningkatkan Kinerja Perusahaan, editor Deddy Mulyana, MA, Ph.D., Pt. Remaja Rosdakarya, Bandung.) Komunikasi harus diarahkan kepada : 1) To be understood – to get something across to some one so that he/she knows exactly what the leaders means. 2) To understand other – to get to know their exact meanings and intentions. 3) To gain acceptance for yourself and/or for your ideas. 4) To produce action – to get the other person or group to understand what is expected when it is needed, why it is necessary and, sometimes, ho to do it. Keempat tujuan seperti dikemukan oleh plunkeet ; 1975 : 49, di atas sangat penting bagi pimpinan organisasi dalam upaya mencapai tujuan organisasi melalui kerjasama dan interaksi dengan orang-orang yang menjadi anggota organisasinya.

28 ( Emmy Fakry Gaffar, Yoyon, B.I, 1997 : 8, Pengembangan Sistem Komunikasi Organisasi, Laboratorium Pengembangan Manajemen, Jurusan Adpend FIP IKIP, Bandung) 2) Keterampilan dalam Mengelola Pekerjaan Keinginan individu dalam pekerjaan yang harus diperhatikan oleh pimpinan dalam membina hubungan dalam pekerjaan : 1. Kami ingin pimpinan yang baik, karena kami tergantung dari kepemimpinan. 2. Kami ingin mendapat pekerjaan, kami ingin mengetahui tujuan yang akan dicapai, dipihak mana kami berada, dan kekuatan-kekuatan apa yang mempengaruhi lingkungan kerja kami. 3. Kami ingin diperlakukan sebagai manusia terhormat, kami adalah manusia yang masing-masing mempunyai masalah dan kebutuhan yang berlainan. 4. Kami ingin perangsang dan kesempatan untuk maju, kami mengharapkan adanya sutau usaha dan kompetisi dengan mereka yang sedang mengalami kemajuan. 5. Kami ingin kebebasan dalam sikap kami sehubungan dengan persoalan kami. 6. Kami ingin hidup bermasyarakat dan ingin penghormatan dari orang-orang lain, kami adalah manusia-manusia bermasyarakat, kami ingin mencegah terjadinya pertentangan pribadi. 7. Kami ingin jaminan kemanan. 8. Kami ingin kondisi dan kesenangan bekerja sejauh kemungkinan yang bisa diberikan kepada kami termasuk upah. 9. Kami ingin melaksanakan pekerjaan yang bermanfaat, kami ingin berprestasi dalam pekerjaan sebagai sumbangan kepada kebutuhan masyarakat, partisipasi akan membantu kami mencapai prstasi. 10. Kami ingin diperlakukan secara jujur, ini adalah keadilan yang mengandung arti bahwa kami akan tetap terus sesuai keadaan. (Onong Uchyana Effendi, 1989 : 27, psikologi manajemen dan Administrasi, Bandung, Mandar Maju) 3) Keterampilan dalam Manajemen Diri Untuk bisa mencapai tingkat intelektual (bawah sadar) harus memperhatikan hukumnya yaitu niat yang positif dan serius, dinyatakan dalam

29 periode masa kini, bersifat pribadi dan selalu diulang-ulang. Selanjutnya kita katakan bahwa kemampuan kita akan lebih produktif bila kita pancing dengan menetapkan tujuan yang berupa visi/misi/nilai-nilai dengan syarat SMART, yang artinya S=spesific, M=Measurable, A=Achiavable, R=Reality based, T=Time. (Triguna Priyadarma, 2001 : 50, Kreativitas dan Strategi, PT. Golden Trayon Pers, Jakarta) Schooling has a variety of customers or stakeholders. They include parents, community leaders, young people, employers, postsecondary education institutions, community groups and some others. The question to be asked under this heading is simple: “What are the current development in the attitudes and behavior of these groups that have a direct effect on both the current operations of schools and what is likely to happen in the future ?” (Stephend Murgatroyd & Colin Morgan, 1993 : 6, Total Quality Management and The School, Open University Press, Buckingham Philadelphia) Ketekunan dimulai dengan integritas, integritas sebagai watak seseorang yang selalu konsekuen dan konsisiten dengan apa yang dikatakan, dianut (agama atau aliran, sumpah atau janji), sehingga orang tersebut mempunyai nilai tersendiri, paling tidak menjadi orang yang dapat dipercaya……Integritas dapat menjadi kenyataan sikap dan perilaku yang klreatif bilamana dimulai dengan komitmen dalam arti yang sebenarnya yaitu berupaya sekuat tenaga apa yang dijanjikan atau apa yang menjadi tujuannya dapat diaktualisasikan dengan berbagai macam cara yang baik efektif dan efisien. Keadaan seperti itu sangat menguntungkan dalam mencapai keberhasilan individual maupun manajemen karena akan terjadi niat memberikan terbaik dari individu-individu kepada orang lain atau organisasinya, jaringan kerja kebersaman, keterbukaan yang mengarah pada visi dan misi dengan strategi dan taktik yang sesuai. (Triguna Priyadarma, 2001 : 23 - 24, Kreativitas dan Strategi, PT. Golden Trayon Pers, Jakarta) Iklim kerjasama yang diharapkan dalam kerangka kreativitas dan pelaksaan inovasi adalah ; iklim yang liberalsme, otonomi, supportiveness, keterbukaan, dan pengambilan resiko secara cermat, dimana komunikasi dan kerjasam dinjunjung tinggi dan didorong. Inovasi diperjuangkan dan

30 diberdayakan dengan penyediaan sumber-sumber, fasilitas-fasilitas, dan waktu. Tugas-tugas dirancang untuk mengembangkan orang-orang yang menjalankannya, dan kualitas dirayakan serta diberi imbalan dalam semua bidang kegiatan organisasi. Orang-orang didorong untuk menetapkan target dalam pekerjaan mereka, dan mereka menerima umpan balik jelas mengenai kinerja mereka. Kesejahteraan dan kemakmuran karyawan adalah kepedulian semua pihak dalam organisasi, dan keragaman angkatan kerja dalam hal gender, latar belakang profesional, ras, kultur nasional, pelatihan, kepribadian, masa kerja di organisasi rijunjung tinggi. (Michael A. West, 2000 : 157 - 158, 195, Developing Cretaivit y In Organizations ; Mengembangkan Kreativitas dalam Organisasi, Kanisius, Yogyakarta) 4) Keterampilan dalam Mengambilan Keputusan Why are decision Hard ? First, a decision can be hard simply because of its complexity, Second, a decision can be difficult because of the inherent uncertainty in the situation., third, a decision maker may be interested in working toward multiple objectives, but progress in one direction may impede progress in others., Fourth and finally, a problem may be difficult in different perspectives lead to different conclusions. (Robert T. Clement, 1991: 2-3, Making hard decisions An Introduction to Decision Analysis, Plus-Kent Publishing Company, Boston) ….terdapat serangkaian langkah yang seyogyanya ditempuh sebelum tindakan memutuskan diambil. Artinya, kelompok cenderung terlalu berorientasi pada tindakan nyata karena mereka mengetahui, bahwa bagi para pemimpin puncak organisasi, yang penting bukan bagaimana kelompok melaksanakan tugasnya, melainkan apakah keputusan yang diambil mendatangkan hasil yang diharapkan atau tidak, setelah terlebih dahulu mempertimbangkan ; a) tujuan yang telah ditentukan sebelumnya, b) berbagai sasaran yang harus dicapai, c) kendala-kendala yang dihadapi oleh organisasi, d) kemampuan yang tersedia dalam organisasi. (Sondang P. Siagian, 1992 : 152-153, Teori dan Praktek Pengambilan Keputusan, CV Haji Masagung, Jkarta) Participative Decision Making di sekolah dapat berbentuk sebagai berikut :

31 1) Partisipasi yang efektif dari guru-guru dalam proses pengambilan keputusan dapat lebih mengefektifkan pencapaian tujuan sekolah. 2) Guru-guru tidak ingin dilibatkan dalam setiap proses pengambilan keputusan. Disamping itu tidak diharapkan demikian. 3) Tugas yang penting dari seorang administrator (kepala sekolah) adalah menentukan kapan guru-guru itu dilbatkan ke dalam proses pengambilan putusan, dan kapan tidak perlu dilibatkan. 4) Peranan guru dalam proses pengmabilan keputusan dapat bermacam-macam, tergantung pada karakteristik masalah. 5) Saat guru dilibatkan dalam proses pengambilan keputusan bergantung pada masalah yang dipecahkan. Ada beberapa syarat untuk menentukan perlu tidaknya bawhan diikutsertakan atau berpartisipasi dalam proses pengambilan putusan yaitu : a) Relevansi ; apakah ada relevansi antara masalah yang dipecahkan dengan kepentingan bawahan. b) Keahlian ; apakah bawahan cukup mempunyai pengetahuan tentang masalah yang akan dipecahkan. c) Jurisdikasi ; apakah anggota atau bawahan mempunyai hak secara legal untuk ikut serta mengambil bagian dalam proses pengambilan keputusan. d) Kesediaan ; apakah bawahan mempunyai kemamuan dan bersedia untuk ikut serta dalam pengambilan keputusan. (Ngalim Purwanto, 1998 : 71, Administrasi dan Supervisi Pendidikan, PT. Remaja Rosdakarya, Bandung) 5) Keterampilan dalam Mengelola Sumber Daya Sumber Daya adalah input bagi proses produksi seperti barang modal, kemampuan para pekerja, hak paten, keuangan, dan manajer berbakat. Model Berbasis Sumber Daya untuk Profitabilitas Tinggi ; 1) Sumber Daya, 2) kemampuan, 3) keunggulan Bersaing yang berkesinambungan, 4) Pemilihan dan penerapan Strategi, 5) Profitabilitas Tinggi (Michael A Hitt, R Duane Ireland, Robert E. Hoskisson (Alih Bahasa Armand Hediyanto), 1997 : 17 s.d 19, manajemen Strategis ; Menyongsong Era Persaingan dan Globalisasi, Erlangga, Jakrata.)

32 Pelibatan masyarakat dalam sekolah memerlukan strategi yang tepat sehingga dalam aktivitasnya bisa secara optimal diperoleh. Customer Journey dengan House of Quality memberikan penjelasan tentang strategi dalam pelibatan masyarakat dalam sekolah yaitu sebagai berikut : The Basic ideas for the house of quality is that designers of program, service, activities, curricula, organizations and learning experiences should be rigorous in understanding just what the customer needs from an experience or product so that the design of the process can meet or exceed these needs. The house comprises a number of rooms, each of which has their own basic function (Stephend Murgatroyd & Colin Morgan, 1993 : 104, Total Quality Management and The School, Open University Press, Buckingham Philadelphia) HOWs vs HOWs HOWs WHYs WHATs WHATs vs HOWs WHYs vs WHATs HOW MUCHes HOW MUCHes vs HOWs WHYs vs HOW MUCHes

33 “…..there are numerous implications that arise from this new mindset about professional development. As an illustration, several guidelines are offered for teachers, principles, and faculties of education. The guidelines for teachers are ; Locate, listen to, and articulate your inner voice. Practice reflection in action, on action, and about action. Develop a risk-taking mentality. Trust processes as well as people. Appreciate the total person in working with others. Commit to working with colleagues. Seek variety and avoid Balkanization. Redefine your role to extend beyond the classroom. Balance work and life. Push and support principals and other administrators to develop interactive professionalism. Commit to continuous improvement and perpetual learning. Monitor and strengthen the connection between your development and student’ development. (Fullan and Hargreaves : 1991) For principals the guidelines are : Understood the culture. Value your teachers : promote their professional growth. Extend what you value. Express what you value. Promote collaboration, not cooptation. Make menus, not mandates. Use bureaucratic means to facilitate, not to constrain. Connect with the wider environment (Fullan & Hargreaves 1991) And for faculties of education, the guidelines are that each faculty should : Commit itself to producing teachers who are agents of educational and societal improvement.

34 Commit itself to continuous improvement through program innovation and evaluation. Value and practice exemplary teaching. Engage in constant inquiry. Model and develop lifelong learning among staff and student. Model and develop collaboration among staff and student. Be respected and engaged as a vital part of the university as a whole. Form partnership with school and others agencies. Be visible and valued internationally in a way that contributes locally and globally. Work collaboratively to build regional, national, and international networks (Fullan :1993) (Thomas R. Guskey and Michael Huberman, 1995 : 265 – 266, Professional Development in Education ; New Paradigms & Practices, Teachers College, New York and London.) Kepmendiknas No.044/U/2002 tentang Dewan Pendidikan dan Komite Sekolah, pada lampiran II Kepmendiknas (A) (I).PENGERTIAN DAN NAMA, butir (1) Komite sekolah asalah badan mandiri yang mewadahi peranserta masyarakat dalam rangka meningkatkan mutu, pemerataan, dan efisiensi pengelolaan pendidikan di satuan pendidikan, baik pada pendidikan pra-sekolah, jalur pendidikan sekolah, maupun jalur pendidikan luar sekolah. (A) (III) TUJUAN, butir (1) Mewadahi dan menyalurkan aspirasi dan prakarsa masyarakat dalam melahirkan kebijakan operasional dan program pendidikan di satuan pendidikan, butir (2) Meningkatkan tanggungjawab dan peranserta masyarakat dalam penyelenggaraan pendidikan di satuan pendidikan, butir (3) Menciptakan suasana dan kondisi transparan, akuntabel, dan demokratis dalam penyelenggaraan dan pelayanan pendidikan yang bermutu di satuan pendidikan. (Kepmendiknas No. 044/U/2002, tentang Dewan Pendidikan dan Komite Sekolah) Hubungan sekolah dengan masyarakat disekitarnya sangat penting. Di satu sisi sekolah memerlukan masukan dari masyarakat dalam menyusun program

35 yang relevan, sekaligus memerlukan dukungan masyarakat dalam melaksanakan program tersebut. Di lain pihak, masyarakat memerlukan jasa sekolah untuk mendapatkan program-program pendidikan sesuai dengan yang diinginkan. Jalinan semacam itu dapat terjadi, jika pimpinan sekolah aktif dan dapat membangun hubungan yang saling menguntungkan, demi anak didik…..Hubungan dengan masyarakat akan tumbuh jika masyarakat juga merasakan manfaat dari keikutsertaannya dalam program sekolah. Manfaat dapat diartikan luas, termasuk rasa diperhatikan dan rasa puas karena dapat menyumbangkan kemampuannya bagi kepentingan sekolah. (Dirjen Dikdasmen, 1999 : 167, Panduan Manajemen Sekolah, Dep. P & K Direjen Dikdasmen direktorat Pendidikan Menengah Umum, Jakarta) 5. Informasi pendukung a. SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. b. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. c. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Seorang pemimpin yang berorientasi pada pencapaian tujuan organisasi, menurut Getzels dan Guba, menekankan pada dimensi : a. Nomotetis; c. Ideografis; b. Demokratis; d. Autokratis. Menurut model kepemimpinan kontingensi, tiga faktor yang menentukan suatu situasi “favorable” bagi pemimpin, yaitu : a) Hubungan pemimpin dan bawahan, situasi, dan struktur tugas; b) Hubungan pemimpin dan bawahan, situasi, dan kekuasaan jabatan; c) Hubungan pemimpin dan bawahan, situasi, struktur tugas kekuasaan jabatan; d) Situasi, struktur tugas, dan kekuasaan jabatan. Yang paling penting diantara tiga faktor tersebut, menurut teori kepemimpinan kontingensi adalah : a. Struktur tugas; c. Situasi; b. Hubungan pimpinan dengan bawahan; d. Kekuasaan jabatan.

36 Teori kepemimpinan tiga dimensi dikemukakan oleh : a. Hendrick C. Boyd; c. William J. Reddin; b. Albert D. Pearce; d. Edward K. Knots. Teori kepemimpinan tiga dimensi mengemukakan adanya empat gaya dasar kepemimpinan. Tiga dari gaya dasar tersebut adalah : a. Integrated, related, dan corelated; b. Dedicated, sparated, dan deserted; c. Corelated, dedicated, dan integrated; d. Sparated, integrated, dan related. 9. dalam kaitannya dengan : a. Tujuan yang hendak dicapai; b. Situasi yang dihadapi; c. Lingkungan kegiatan; d. Komposisi bawahan. Gaya kepemimpinan eksekutif dapat terjadi bila pemimpin : a. Memberi kepercayaan dan kemudahan untuk berkembang kepada bawahan; b. Mendelegasikan wewenang kepada bawahan untuk mengambil keputusan; c. Memenuhi kebutuhan anggota dalam menetapkan dan mencapai tujuan serta memperhatikan hubungan antar anggota; d. Memiliki tatakerja yang berstruktur dan jelas bagi anggotanya. Teori kepemimpinan situasional dikembangkan oleh : - Paul Hersey dan Kenneth H. Blanchard; - Hemphill dan Coons; - Paul Hersey dan Coons; - Hemphill dan Kenneth H. Blanchard. Diantara faktor-faktor berikut yang merupakan faktor penting menentukan dalam teori kepemimpinan situasional adalah : - Pemimpin; c. Organisasi; - Pengikut; d. Tuntutan kerja dan waktu. Teori kepemimpinan situasional berasumsi bahwa hubungan yang efektif antara pemimpin dengan pengikut tergantung pada : - Taraf kematangan pengikut dan kemauan pemimpin untuk menyesuaikan orientasinya; - Taraf kemampuan pemimpin dan kesediaan pengikut untuk memahaminya; - Sifat organisasi dan kesesuaian pengikut dalam organisasi; - Sifat organisasi dan kejelasan tuntutan kerja dan waktu. 10. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89%= baik 70% - 79% = cukup < 70% = kurang

37 Pertemuan 5 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar; - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran; Kepemimpinan dan kekuasaan adalah dua sisi mata uang yang tidak dapat dipisahkan, dan apabila terjdi pemisahan dalam prakteknya akan menimbulkan berbagai asumsi terhadap kepemimpinan dan kekuasaan secara terpisah-pisah. Pemisahan keduanya akan menampakan bahwa seseorang berkuasa akan tetapi tidak memiliki kepemimpinan artinya dia bukan pemimpin akan tetapi memiliki kekuasaan yang tinggi dibalik layar. Sebaliknya ketika dia menjalankan kepemimpinan tanpa memiliki kekuasaan, maka sebenarnya dia akan diasumsikan hanya sebagai boneka dari seseorang. Dibawah ini, disajikan bagaimana kita menganalisis kekuasaan dari berbagai dimensi yang memungkinkan kita bisa melihat seberapa besar kekuasaan yang dimiliki oleh seseorang kekita dia menjadi pemimpin, yaitu sebagai berikut: 1. Mengapa orang berkuasa atas orang lain? Kelebihan apa yang dimilikinya? - Basis kekuasaan yang dimilikinya. Basis kekuasaan yang dipergunakan oleh orang dalam menjalankan kepemimpinannya dapat diidentifikasi kedalam beberapa basis, seperti; 1)

38 Coercive power, orang lebih suka dengan menggunakan paksaan-paksaan agar orang lain dapat tunduk dan patuh kedalam peritah dan keinginanya. 2) Reward power, orang dengan basis ini mengutamakan kepuasaan orang lain dengan perolehan bentuk materi maupun non-materi sehingga dia dapat dengan leluasa menjalankan kepemimpinanya. 3) Connection power, ketergantungan orang-perorang baik secara individu maupun kelompok dalam organisasi menjadikan alat bergantung untuk memegang tampuk kekuasaan. 4) Information power, sejumlah informasi yang dikuasainya menjadikan dia dapat menguasai orang lain dan menggerakannya sesuai dengan keinginan. 5) Referent power, dimata orang lain dia memiliki sejumlah hal yang memiliki nilai yang luhur yang memungkinkan dia akan memipin dengan baik. 6) Legal power, orang berkuasa karena memang benar-benar secara legal dia memperoleh dukungan dari orang dengan bukti-bukti sah sebagai penguasa. - Sumber daya yang mendukungnya. Sumber daya adalah alat yang memberikan kemudahan bagi seseorang untuk memegang tampuk kekuasaan, baik itu yang bersifat human element maupun material element. 2. Alat apa yang dipergunakannya ? - Ideologi Pemahaman tentang sesuatu. Sejumlah Indoktrinasi. - Ekonomi Bagaimana memperoleh hasil dengan sejumlah usaha yang dilakukan, sebagai perseorangan atau dalam bentuk badan usaha Penguasaan sumber-sumber daya/dana yang fital bagi hidup orang lain - politik How to get the power? Memainkan peranan sebagai sentral yang mayoritas atau minoritas yang mewakili mayoritas - Budaya

39 Hasil rasa dan karsa atau karya yang menjadikan orang secara tidak sadar terpolakan perilakunya, atau yang secara sadar merasa baik untuk mengadopsinya menjadi bagian dari perilakunya. Budaya masa bodoh (permisive) - Militer Kekuasaan dengan kekuatan-kekuatan militerisme Kekuasaan dengan senjata - Komunikasi Nilai dari pesan (massage) Kedudukan dalam komunikasi (retorika) Media komunikasi yang dipergunakan Jaringan komunikasi (teknologi) 3. Target/Tujuan. Kepatuhan Sampai sejauhmana nilai kepatuhan itu? a. Ketakutan (untuk menghindari ancaman-ancaman atau teror yang terjadi) b. Self-Identifine (patuh karena cinta) – Poppy love. c. Tradisional (kepatuhan pada tingkat emosional secara sosio kultural) d. Perhitungan (kepatuhan karena suatu perhitungan-perhitungan tertentu bedasarkan untung rugi – kalkulatif) e. Kesesuaian nilai-nilai (kepatuhan karena ikatan-ikatan yang bersifat normatif – nilai yang hakiki dalam kehidupan). 4. Bagaimana Menjinakan Kekuasaan. a. Proses demokratisasi Bagaimana kekuasaan menjadi merata dengan pendistribusian kekuasaan yang terpusat menjadi bagian-bagian b. Penguasaan sumber daya Menguasai sumber-sumber daya yang potensial bagi kebanyakan

40 Menguasai sumber-sumber dana c. Pengembangan propaganda Ungkapan-ungkapan / ekspresi atas kekuasaan yang berlangsung. Ide-ide inovasi, perubahan, pengembangan dalam berbagai bidang kehiupan d. Sosialisasi secara psikologis dan edukasional Sumber yang memiliki sifat jangka panjang Bagaimana mempersiapkan sumber daya manusia untuk dapat menandingi kekuasaan yang berlangsung. 5. Informasi pendukung - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL–Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL–Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Untuk menentukan gaya kepemimpinan yang cocok pada suatu situasi kegiatan apakah yang pertama-tama harus dilakukan pemimpin menurut teori situasional : - Menjelaskan kepada pengikut situasi yang dihadapi organisasi; - Menjelaskan tugas-tugas individu atau kelompok dalam organisasi; - Mengukur taraf individu atau kelompok yang dipimpin; - Mengukur kesediaan pengikut menerima tugas yang diberikan. Gaya kepemimpinan efektif “telling” menurut situasinal adalah : - Perilaku pemimpin yang memberikan tekanan tinggi baik pada tugas maupun hubungan; - Perilaku pimpinan yang memberikan tekanan tinggi pada hubungan tetapi dengan tugas yang rendah; - Perilaku pemimpin yang memberikan tekanan rendah baik pada tugas maupun hubungan; - Perilaku pemimpin yang memberikan tekanan tinggi pada tugas tetapi rendah pada hubungan. Produktivitas suatu pekerjaan sebagian besar tergantung pada kemauan pekerja untuk menghasilkan sesuatu. Pernyataan ini merupakan anggapan yang dianut oleh: - Teori situasional; c. Teori kontingensi; - Teori motivasi; d. Teori Keperilakuan. Teori X dan Teori Y dikembangkan oleh :

41 - Frederick Herzberg; c. Dauglas Mc. Gregor; - Bernard Mauser; d. Barbara Snyderman. Salah satu asumsi dari teori X adalah : - Manusia itu malas bekerja; - Manusia tidak memiliki rasa tanggungjawab; - Mengendalikan diri itu penting; - Manusia itu memiliki rasa tanggungjawab. Salah satu asumsi teori Y adalah : - Manusia hanya akan bekerja bila diperintah; - Manusia tidak memiliki rasa tanggungjawab; - Bekerja pada umumnya sama dengan bermain; - Manusia tidak memiliki kemampuan berkreasi. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : - Memberi kepercayaan kepada bawahan; - Membuat tugas dengan jelas dan berstruktur; - Mendorong bawahan untuk berinisiatif; - Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : - Kekuasaan, rasa aman, dan keberhasilan; - Rasa aman, keberhasilan, dan kekuasaan; - Penghargaan, rasa aman, dan afisiasi; - Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; - Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; - Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan. Ciri-ciri pemimpin yang efektif antara lain : - Bersedia melepaskan sebagian wewenangnya kepada bawahan, dan menumbuhkan motivasi bawahan, serta mampu mendorong bawahan mencari jalan pemecahan masalah yang dihadapi; - Senang bergaul dengan bawahan, bersedia melepaskan sebagian wewenangnya kepada bawahan, dan dapat menumbuhkan motivasi bawahan; - Dapat mengidentifikasi staf yang berbakat, bersedia melepaskan wewenangnya kepada bawahan, dan mampu mendorong bawahan mencari jalan pemecahan permasalahan yang dihadapi; - Mau belajar sepanjang hidupnya, mau bergaul dengan bawahan, dan mapu memobilitas bawahan. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas.

42 Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

43 Pertemuan 6 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar; - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran; Menurut hasil penelitian yang dilakukan oleh Ohio State University, dibedakan adanya dua macam perilaku kepemimpinan yaitu ; Initiating Structure and Consideration. Dua pola orientasi kepemimpinan tersebut digambarkan dalam bentuk kuadran kombinasi antara initiating structure dan consideration; Low Structure & High Consideration Low Structure & Low Consideration High Structure & High Consideration High Structure & Low Consideration CONS I DERAT I ON INITIATING STRUCTURE

44 The OHIO State Leadership Quadrants (Agus Darma : 1992) Perilaku kepemimpinan struktur tugas mengandung ciri-ciri sebagai berikut : Mengutamakan tercapainya tujuan; Mementingkan produksi yang tinggi; Lebih banyak melakukan pengarahan; Melakukan pengawasan secara ketat; Penilaian terhadap pejabat yang semata-mata berdasarkan hasil tugas. Perilaku kepemimpinan konsidarasi mengandung ciri-ciri sebagai berikut : Memperhatikan kebutuhan bawahan; Berusaha menciptakan suasana saling percaya; Simpati terhadap bawahan; Memiliki sifat bersahabat; Lebih mengutamakan pengarahan diri, mendisiplin diri, mengontol diri. Dalam perilaku inisiasi struktur terdapat perilaku yang menunjukkan dengan tegas pola-pola hubungan antara pemimpin dengan yang dipimpin, menjelaskan bagaimana pola-pola organisasi yang ada, saluran-saluran komunikasi, dan cara-cara dalam menjalankan semua pekerjaan yang ada dalam organisasi. Sedangkan pola-pola perilaku dalam konsiderasi mengacu pada perilaku yang menunjukkan hubungan bersahabat, saling memegang kepercayaan, kehangatan, perhatian, dan respek dalam hubungan antara pemimpin dengan orang-orang yang dipimpinnya. Hasil penelitaian dari Ohio State University ini didukung oleh hasil dari Survey Research Center Michigan University, dengan dua macam perilaku kepemimpinan yaitu Job Centered (Production Orientation) dan Employee Centered (Employee Orientation) yang memiliki pengertian yang sama dengan yang dikeluarkan oleh Ohio State University.

45 Teori yang lain memberikan gambaran tentang model orientasi kepemimpinan dalam bentuk perilaku yang diperlihatkan, yaitu teori Managerial Grid dari Robert K. Blake and James S. Mouton. Dalam teori ini dikenal lima gaya kepemimpinan yang merdasarkan kepada dua model orientasi kepemimpinan yaitu : Concern for Production and Concern for People, Penekanan pada produksi dan tugas dan penekanan pada hubungan antar individu. Teori tersebut digambarkan dalam bentuk seperti terlihat di bawah ini: The Managerial Grid Leadership Style (Agus Darma : 1992) Dari kombinasi di atas terdapat lima gaya kepemimpinan yang beranjak dari dua model orientasi kepemimpinan yaitu sebagai berikut : 1. Impoverished, pemimpin menggunakan usaha yang paling sedikit untuk menyelesaikan tugas tertentu dalam hal ini dianggap cukup mempertahankan organisasi. 2. Country Club, Kepemimpinan yang mendasarkan kepada hubungan informal antara individu, keramahtamahan dan kegembiraan. Tekanan terletak pada hubungan kemanusiaan. 1-9 COUNTRY CLUB 1-1 IMPOVERISHED 9-9 TEAM 9-1 TASK CONCERN FOR PEOPLE CONCERN FOR PRODUCTION 5-5 MIDLE ROAD

46 3. Task, Pemimpin memiliki pandangan bahwa efesiensi kerja sebagai faktor utama untuk keberhasilan organisasi. 4. Middle Road, adanya keseimbangan yang maksimal antara tugas dan hubungan antar individu. 5. Team, keberhasilan suatu organisasi bergantung kepada kelompok-kelompok dalam organisasi (kepemimpinan kelompok). Kepemimpinan harus mengarah kepada proses yang sinergi dalam upaya menemukan solusi dalam konflik dengan memposisikan pada win-win solution. Menang-menang bukanlah teknik kepribadian, melainkan paradigma total interaksi manusia yang berasal dari karakter integritas, kematangan dan mentalitas tinggi. Menang-menang tumbuh dari hubungan dengan kepercayaan tinggi, dan diwujudkan dalam kesepakatan yang secara efektif menjelaskan dan memanajemeni harapan dan juga pencapaian. Untuk lebih jelasnya seperti gambar berikut : PRINSIP MENANG/MENANG Prinsip Menang-Menang (Triguna Priyadarma : 2001) Low Structure & High Consideration Low Structure & Low Consideration High Structure & High Consideration High Structure & Low Consideration PERTIMBANGAN KEBERANIAN TINGGI RENDAH RENDAH TINGGI

47 Peranan pemimpin dalam manajemen sekolah tidak tebatas pada hal tersebut di atas, dalam bidang personalia saja. Akan tetapi berkaitan dengan kegiatan-kegiatan manajer sekolah peranan lainnya berada dalam tatanan perencanaan, pengorganisasian, pengawasan, motivasi, dan komunikasi pada level sistem pendidikan nasional, seperti gambar berikut ini : Management Process (C. Turney & Friend : 1992) 5. Informasi pendukung - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) P O C M C Class Room School School Community Education System Class Room Class Room School School School Community School Community Education System Education System ROLES & TASK CONTEXS

48 8. Evaluasi Untuk memilih gaya kepemimpinan yang paling efektif Tannembaun dan Schmidt menyerahkan tiga untuk dipertimbangkan yaitu : - Kekuatan diri pemimpin, kekuatan bawahan, dan situasi; - Kekuatan diri pemimpin, kekuatan bawahan, dan tujuan; - Kekuatan pemimpin, situasi, dan tujuan; - Kekuatan bawahan, situasi, dan tujuan. Gaya kepemimpinan kolaboratif menurut Rita Dunn dan Kenenth Dunn adalah gaya kepemimpinan yang baru : - Menunjuk adanya keakraban antara pemimpin dengan anggota kelompok; - Adanya pembagian kepemimpinan kepada staf; - Memberi kesempatan kepada staf untuk memberikan saran atau ide; - Mempunyai sedikit ruang gerak bagi staf untuk berperan serta. Getzel dan Guba mengemukakan dua gaya kepemimpinan, yaitu : - Normatif dan partisipatif; c. Partisipatif dan personal; - Normatif dan personal ; d. Partisipatif dan birokratis. Seorang pemimpin yang berorientasi pada pencapaian tujuan organisasi, menurut Getzels dan Guba, menekankan pada dimensi : - Nomotetis; c. Ideografis; - Demokratis; d. Autokratis. Menurut model kepemimpinan kontingensi, tiga faktor yang menentukan suatu situasi “favorable” bagi pemimpin, yaitu : - Hubungan pemimpin dan bawahan, situasi, dan struktur tugas; - Hubungan pemimpin dan bawahan, situasi, dan kekuasaan jabatan; - Hubungan pemimpin dan bawahan, situasi, struktur tugas kekuasaan jabatan; - Situasi, struktur tugas, dan kekuasaan jabatan. Yang paling penting diantara tiga faktor tersebut, menurut teori kepemimpinan kontingensi adalah : - Struktur tugas; c. Situasi; - Hubungan pimpinan dengan bawahan; d. Kekuasaan jabatan. Teori kepemimpinan tiga dimensi dikemukakan oleh : - Hendrick C. Boyd; c. William J. Reddin; - Albert D. Pearce; d. Edward K. Knots. Teori kepemimpinan tiga dimensi mengemukakan adanya empat gaya dasar kepemimpinan. Tiga dari gaya dasar tersebut adalah : - Integrated, related, dan corelated; - Dedicated, sparated, dan deserted; - Corelated, dedicated, dan integrated; - Sparated, integrated, dan related. Gaya kepemimpinan yang efektif menurut teori tiga dimensi hanya dapat dipahami dalam kaitannya dengan : - Tujuan yang hendak dicapai; - Situasi yang dihadapi; - Lingkungan kegiatan; - Komposisi bawahan. Gaya kepemimpinan eksekutif dapat terjadi bila pemimpin : - Memberi kepercayaan dan kemudahan untuk berkembang kepada bawahan; - Mendelegasikan wewenang kepada bawahan untuk mengambil keputusan; - Memenuhi kebutuhan anggota dalam menetapkan dan mencapai tujuan serta memperhatikan hubungan antar anggota; - Memiliki tatakerja yang berstruktur dan jelas bagi anggotanya.

49 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

50 Pertemuan 7 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar; - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran; 1) Perilaku Dan Budaya Organisasi Perilaku organisasi sebagai suatu studi yang menyangkut aspek-aspek tingkah laku manusia dalam suatu organisasi atau suatu kelompok tertentu. Ia meliputi aspek yang ditimbulkan dari pengaruh organisasi terhadap manusia, demikian pula aspek yang ditimbulkan dari pengaruh manusia terhadap organisasi. Pendekatan perilaku dalam organisasi mempertaruhkan manusia dalam organisasi sebagai suatu unsur yang komplek, dan oleh karenanya adanya suatu kebutuhan pemahaman tentang teori organisasi yang didukung oleh riset yang empiris sangat diperlukan sebelum diterapkan dalam mengelola manusia itu sendiri. (Bagaimana Seyogyanya orang) mendekati situasi dimana manajer mungkin harus memilih antara dua alternatif, alternatif yang satu lebih manusiawi dan yang lain lebih produktif ? Alternatif mana yang seyogyanya dimaksimumkan manajer ? (Henry L. Tosi;1981)

51 Model Perilaku Organisasi OTOKRATIK KUSTODIAL SUPORTIF KOLEGIAL Basis Kuasa Kuasa Sumber Daya ekonomi Kepemimpinan Kemitraan Orientasi manajerial Wewenang Uang Dukungan Kerja Tim Orientasi Pegawai Kepatuhan Rasa Aman & Maslahat Prestasi Kerja Tanggungjawab Hasil Psikologi Pegawai Bergantung pada atasan Bergantung pada Organisasi Partisipasi Swadisiplin Kebutuhan Pegawai yang terpenuhi Kebutuhan Pokok Rasa Aman Status dan Pengakuan Perwujudan diri Hasil Prestasi Minimum Kerjasama Pasif Timbulnya Dorongan Antusiasme secukupnya Kaitannya dengan gagasan lain Hirarki kebutuhan Maslow Fisiologis Rasa Aman Kebutuhan Tingkat Menengah Kebutuhan Tingkat Tinggi Dua faktor Herzberg Pemeliharaan Pemeliharaan Motivasi Motivasi Lingkungan Motivasional ekstrinsik Ekstrinsik Intrinsik Intrinsik Teori McGregor Teori X Teori X Teori Y Teori Y Gaya Kepemimpinan Negatif Kebanyakan Netral dalam Pekerjaan Positif Positif Manajerial Grid Blake & Mouton 9,1 3,5 6,6 8,8 Kecenderungan Dalam Perilaku Organisasi Dari Ke Sistem tertutup Orientasi materialistik Pemusatan kuasa Motivasi ekstrinsik Sikap negatif terhadap orang-orang Berfokus pada kebutuhan organisasi Menekankan disiplin Peran manajemen yang otoritatif Sistem terbuka Orientasi manusia Penyebaran kuasa Motivasi intrinsik Sikap positif tentang orang-orang Keseimbangan focus pada kebutuhan pegawai dan organisasi Swadisiplin Peran manajemen atas dasar kepemimpinan dan dukungan tim Pendekatan Perilaku Organisasi 1. Pendekatan sistem Apa yang diperlukan dalam perilaku organisasi adalah perkayaan keseluruhan sistem sosioteknis secara berangsur-angsur untuk membuatnya lebih sesuai dengan orang-orang. 2. Pendekatan Kontingensi

52 Perilaku organisasi diterapkan dalam hubungan kontingensi, yaitu tidak semua organisasi membutuhkan kadar partisipasi, komunikasi terbuka, atau kondisi lainnya persis sama untuk efektif. 3. Pendekatan Sosial Bahwa apa yang terjadi di luar organisasi akan mempengaruhi praktik perilaku organisasi Penerapan gagasan kontingensi dalam organisasi pada lingkungan yang stabil dan berubah-ubah. Lingkungan Karakteristik Organisasi Stabil Berubah-ubah Struktur Hiraraki lebih kaku Lebih luwes (proyek Dan matriks) Sistem Produksi Lebih banyak spesialisasi Lebih banyak pemerkayaan pekerjaan Gaya Kepemimpinan Lebih terstruktur Lebih konsiderasi Model Perilaku Organisasi Lebih Otokratik Lebih suportif Ukuran Prestasi Lebih menekankan manajemen berdasarkan sasaran Lebih menekankan manajemen berdasarkan sasaran Budaya, dalam arti antropologi dan sejarah, adalah inti dan kelompok atau masyarakat tertentu – apa yang berbeda mengenai cara para anggotanya saling berinteraksi dengan orang dari luar lingkungan – dan bagaimana mereka menyelesaikan apa yang dikerjakannya. Budaya organisasi…adalah serangkuman nilai brsama yang mengendalikan interaksi anggota organisasi satu sama lain dan interaksi anggota orang-orang di luar organisasi. Budaya organisasi dibentuk oleh orang-orang dalam organisasi, terdiri dari etika, hak-hak kerja yang diberikan kepada pegawai dan corak struktur yang dignakan oleh organisasi. (Struktur ; tujuan, manager, psikososial, teknik organisasi, peraturan, pembagian kerja dan wewenang, fungsi, uraian tugas, hubungan kerja) Organization Culture ; The customary of traditional ways of thinking and doing things, which are shared to a greather or lesser extent by all member of the organization and which new numbers must learn and at least partially accept in order to be accepted into the service of the firm.

53 Organization Culture ; A pattern of basic assumptions-invented, discovered, or developed by a given group as it learns to cope with its problem of external adaptation and internal integration – that has worked, well enough to be considered valuable and, therefore, to be taught to new members as the correct way to perceive, think, and feel in relation to those problems. Karakteristik Budaya Organisasi 1. Observed behavior regularities, aturan tingkah laku yang dapat diamati 2. Norms, norma-norma 3. Dominant values, nilai-nilai yang dominan 4. Philosophy, nilai-nilai filosofi 5. Rules, peraturan-peraturan 6. Organizational climate, iklim organisasi Fungsi Budaya Organisasi 1. Menentukan apa yang mendasari hal yang penting terhadap organisasi, standar kebutuhan dan kegagalan harus bisa diukur 2. Memerintahkan bagaimana sumber-sumber organisasi digunakan dan untuk keperluan apa 3. Menciptakan apa organisasi dan anggotanya dapat mengharapkan satu sama lain 4. Membuat beberapa metode pengontrolan perilaku dalam keabsahan organisasi dan membuat yang lain tidak absah, yaitu menentukan dimana kekuasaan terletak dalam organisasi dan bagaimana menggunakannya 5. Menyaring perilaku dimana anggotanya harus terlibat dan tidak harus terlibat Dan menentukan bagaimana hal ini diberi ganjaran dan hukuman 6. Menentukan suatu tatanan bagaimana anggota organisasi harus memperlakukan satu sama lainnya dan bagaimana mereka harus memperlakukan bukan anggota organisasi 7. Mengintruksikan anggotanya tentang bagaimana untuk berhubungan dengan lingkungan luar; secara agresif, eksposif, bertanggungjawab atau proaktif.

54 2) Lingkungan Organisasi Beberapa tantangan lingkungan organisasi ; “sistem itu lebih mudah binasa kalau sistem tersebut tetap melakukan pencarian keuntungan dalam masyarakat dengan cara-cara yang tidak dapat diterima, karena kalau cara yang tidak dapat diterima, karena kalau sistem itu telah menjadi sangat buruk bagi timbulnya keinginan untuk menggunakan para aparatur politik kita, penyembuhan yang hebat akan diperlukan dan malah lebih hebat lagi penyembuhan itu akan menjadikan seseorang menjadi terkenal”. Sejak suatu organisasi dibentuk dalam suatu lingkungan eksternal, penyesuaian organisasi melalui penerusan interaksi pada lingkungan adalah sangat dibutuhkan Beberapa tantangan organisasi yang harus diperhatikan guna kelangsungan hidup organisasi : 1) Ekologi 2) Sistem upah dan kebijaksanaan personalia 3) Golongan konsumen 4) Riset dan pengembangan kefektivan produk 5) Kebijaksanaan internasional 6) Keseimbangan perekonomian nasional Penilaian Lingkungan Eksternal, berguna untuk menggali lingkungan di luar organisasi untuk mengidentifikasi peluang dan ancaman yang dihadapi organisasi 1) Isu dan kecenderungan yang berkaitan dengan pajak 2) Perubahan nilai sosial politik 3) Kecenderungan komputasi, komunikasi dan sistem informasi 4) Peningkatan dalam beban tanggungjawab dan manajemen resiko 5) Perawatan kesehatan 6) Isu-isu lainnya, pemulihan akibat bencana, pergerakan hak-hak asasi, dan lain-lain

55 Penilaian Lingkungan Internal, untuk menilai lingkungan internal organisasi guna mengidentifikasi kekuatan dan kelemahannya, aspek-aspek yang membantu atau merintangi pencapaian tujuan organisasi 1) Sumber daya (input) 2) Strategi sekarang (porses) 3) Kinerja (output) 3) Manajemen Lingkungan Organisasi Disamping ciri organisasi seperti struktur dan teknologi, dimensi kritis kedua bagi keberhasilan organisasi adalah lingkungan organisasi. Lingkungan organisasi dibagi menjadi dua bagian ; 1) Lingkungan luar, yang pada umumnya menggambarkan kekuatan yang berada di luar organisasi, misalnya kondisi pasar, kondisi ekonomi, dll. 2)Lingkungan dalam, yaitu faktor-faktor di dalam organisasi yang menciptakan milieu kultural dan sosial tempat berlangsungnya kegiatan ke arah tujuan organisasi. Tiga konsep tentang lingkungan luar organisasi ; 1)lingkungan sebagai segala hal di luar organisasi, dengan perkataan lain lingkungan luar adalah apa yang tersisa setelah batas-batas organisasi ditentukan. 2)Bila kita mengikuti perspektif sistem maka sulit untuk mengenali batas yang sekaligus menjadi titik akhir organisasi dan titik tolak lingkungan. 3) Secara abstrak mencoba mengidentifikasi komponen-komponen dari lingkungan. Ketidakmantapan dalam lingkungan akan memberikan pengaruh terhadap suatu organisasi, akan tetapi dipandang secara relatif hal ini juga mungkin tidak akan menimbulkan ketidakefektivan dalam organisasi. Hipotesis pengaruh lingkungan terhadap efektivitas organisasi :

56 Ciri-Ciri Lingkungan Umum Untuk Organisasi Kebudayaan, termasuk latar belakang sejarah, ideology, nilai-nilai, dan norma-norma masyarakat. Pandangan mengenai hubungan-hubungan wewenang, pola kepemimpinan, hubungan antar pribadi, rasionalisme, ilmu, dan teknologi menentukan sifat lembaga-lembaga sosial. Teknologi. Tingkat kemajuan ilmu dan teknologi dalam masyarakat, termasuk basis fisik (pabrik, peralatan, fasilitas) dan dasar pengetahuan teknologi. Tingkat kemampuan ilmiah dan teknologi masyarakat untuk mengembangkan pengetahuan baru dan penerapannya. Pendidikan. Tingkat melek-aksara umum dari penduduk. Tingkat kecanggihan (sophistication) dan spesialisasi dalam sistem pendidikan. Persentase penduduk dengan profesional tinggi dan/atau mempunyai keahlian khusus. Politik. Iklim politik umum masyarakat. Tingkat konsentrasi kekuatan politik. Sifat organisasi politik (tingkat desentralisasi, keanekaragaman fungsi, dsb). Sistem partai politik. Hukum. Faktor-faktor konstitusional, sifat sistem hukum, kewenangan berbagai instansi pemerintah. Undang-undang khusus mengenai pembentukan,perpajakan, dan kontrol organisasi. Sumber-daya alam. Sifat.kuantitas, dan tersedianya sumber daya alam, termasuk keadaan iklim dan keadaan lainnya. Ketepatan Persepsi Mengenai Keadaan Lingkungan Efektivitas Organisasi Ketepatan Tanggapan Organisasi terhadap Rangsangan Lingkungan Tingkat Keterdugaan Keadaan Lingkungan Kerukitan Lingkungan Kemantapan Lingkungan Tingkat Rasionalitas Organisasi

57 Kependudukan. Sifat sumber daya manusia yang tersedia dalam masyarakat; jumlah, distribusi, usia dan jenis kelamin. Konsentrasi atau urbanisasi penduduk merupakan suatu ciri-ciri masyarakat industri. Sosiologi. Struktur kelas dan mobilitasnya. Perumusan peranan-peranan sosial. Sifat organisasi sosial dan perkembangan lembaga-lembaga sosial. Ekonomi. Kerangka-kerja ekonomi umum, termasuk tipe organisasi ekonomi- pemilikan swasta dan negara; sentralisasi atau desentralisasi perencanaan ekonomi; sistem perbankan; dan kebijakan fiscal. Level investasi dalam sumber daya fisik dan ciri-ciri konsumsi. 4) Manajemen Perubahan Organisasi merupakan suatu sistem yang bersifat terbuka, karena organisasi selalu melakukan interaksi dan interelasi dengan lingkungannya. Keadaan lingkungan tempat organisasi itu berada bersifat dinamis, karena selalu terjadi gejolak dan perubahan. Gejolak dan perubahan yang terjadi dalam masyarakat secara sadar atau tidak dapat mempengaruhi kehidupan organisasi. Perubahan yang terjadi dalam masyarakat seperti perubahan nilai yang berdampak terhadap perubahan perilaku sosial, perubahan yang terjadi dalam cara pandang terhadap pendidikan, pekerjaan dan penghidupan serta cara hidup, perubahan sistem sosial, politik dan ekonomi yang demikian cepat, dalam banyak hal ikut mempengaruhi hidup matinya organisasi. Tantangan yang menyebabkan organisasi melakukan perubahan datang dari luar maupun dari dalam organisasi. Tantangan penyebab perubahan dari dalam organisasi misalnya, volume kegiatan yang bertambah banyak, adanya peralatan baru, perubahan tujuan organisasi, penambahan tujuan organisasi, perluasan wilayah kegiatan, tingkat pengetahuan, tingkat keterampilan, sikap, serta perilaku para pegawai. Tantangan penyebab perubahan yang berasal dari lingkungan luar organisasi, adanya peraturan baru, perubahan kebijakan dari organisasi tingkat yang lebih tinggi, perubahan selera masyarakat terhadap hasil organisasi, perubahan gaya hidup masyarakat, dll.

58 Perubahan yang terjadi pada organisasi sebagai akibat adanya masalah dan tantangan tersebut, terlihat pada : 1) Merubah struktur,; menambah satuan, mengurangi satuan, merubah kedudukan satuan, menggabung beberapa satuan menjadi satuan yang lebih besar, memecah satuan-satuan yang besar menjadi lebih kecil, merubah sistem sentralisasi menjadi desentralsasi atau sebaliknya, merubah luas sempitnya rentangan kontrol, memerinci kembali kegiatan atau tugas, menambah atau mengurangi pejabat. 2) Merubah tata kerja yang dapat meliputi tatacara, tataaliran, tatatertib, dan syarat-syarat melakukan kerja. 3) Merubah orang, dalam pengertian merubah sikap, tingkah laku, meningkatkan pengetahuan, dan keterampilan dari para pegawai. 4) Merubah peralatan kerja. Beberapa hal kecenderungan organisasi pada masa ang akan datang ; 1) Perubahan peranan dan tujuan organisasi, selain mencari keuntungan juga memberikan kemanfaatan sosial. 2) Membesarnya kompleksitas organisasi 3) Tujuan organisasi menjadi lebih kompleks 4) Penggunaan teknologi yang lebih maju 5) Perubahan pandangan terhadap manusia 6) Adanya bentuk organisasi yang baru Jenis-jenis kondisi organisasi yang memerlukan pengembangan organisasi antara lain ; 1) Kebutuhan akan peruabahn strategi kepemimpinan. 2) Kebutuhan akan iklim organisasi yang lebih serasi dengan kebutuhan individu dan kebutuhan lingkungan yang terus berubah. 3) Kebutuhan untuk merubah “norma kebudayaan”. Hal ini karena organisasi didalmnya terdapat sistem nilai, peraturan dasar, norma, atau struktur kekuasaan, suatu ketika dirasakan oleh pimpinan untuk mengadakan hal-hal tersebut di atas, agar organisasi lebih konsisten dan dapat merespon tuntutan lingkungan.

59 4) Kebutuhan unuk merubah struktur dan peranan. 5) Kebutuhan akan perbaikan dalam kolaborasi dalam kelompok. 6) Kebutuhan akan sistem komunikasi yang terbuka. 7) Kebutuhan akan perencanaan yang lebih baik. 8) Kebutuhan akan perubahan mitovasi dan staf/personil. 5. Informasi pendukung - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Untuk menentukan gaya kepemimpinan yang cocok pada suatu situasi kegiatan apakah yang pertama-tama harus dilakukan pemimpin menurut teori situasional : - Menjelaskan kepada pengikut situasi yang dihadapi organisasi; - Menjelaskan tugas-tugas individu atau kelompok dalam organisasi; - Mengukur taraf individu atau kelompok yang dipimpin; - Mengukur kesediaan pengikut menerima tugas yang diberikan. Gaya kepemimpinan efektif “telling” menurut situasinal adalah : - Perilaku pemimpin yang memberikan tekanan tinggi baik pada tugas maupun hubungan; - Perilaku pimpinan yang memberikan tekanan tinggi pada hubungan tetapi dengan tugas yang rendah; - Perilaku pemimpin yang memberikan tekanan rendah baik pada tugas maupun hubungan; - Perilaku pemimpin yang memberikan tekanan tinggi pada tugas tetapi rendah pada hubungan. Produktivitas suatu pekerjaan sebagian besar tergantung pada kemauan pekerja untuk menghasilkan sesuatu. Pernyataan ini merupakan anggapan yang dianut oleh: - Teori situasional; c. Teori kontingensi; - Teori motivasi; d. Teori Keperilakuan. Teori X dan Teori Y dikembangkan oleh : - Frederick Herzberg; c. Dauglas Mc. Gregor; - Bernard Mauser; d. Barbara Snyderman. Salah satu asumsi dari teori X adalah : - Manusia itu malas bekerja;

60 - Manusia tidak memiliki rasa tanggungjawab; - Mengendalikan diri itu penting; - Manusia itu memiliki rasa tanggungjawab. Salah satu asumsi teori Y adalah : - Manusia hanya akan bekerja bila diperintah; - Manusia tidak memiliki rasa tanggungjawab; - Bekerja pada umumnya sama dengan bermain; - Manusia tidak memiliki kemampuan berkreasi. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : - Memberi kepercayaan kepada bawahan; - Membuat tugas dengan jelas dan berstruktur; - Mendorong bawahan untuk berinisiatif; - Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : - Kekuasaan, rasa aman, dan keberhasilan; - Rasa aman, keberhasilan, dan kekuasaan; - Penghargaan, rasa aman, dan afisiasi; - Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; - Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; - Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan. Ciri-ciri pemimpin yang efektif antara lain : - Bersedia melepaskan sebagian wewenangnya kepada bawahan, dan menumbuhkan motivasi bawahan, serta mampu mendorong bawahan mencari jalan pemecahan masalah yang dihadapi; - Senang bergaul dengan bawahan, bersedia melepaskan sebagian wewenangnya kepada bawahan, dan dapat menumbuhkan motivasi bawahan; - Dapat mengidentifikasi staf yang berbakat, bersedia melepaskan wewenangnya kepada bawahan, dan mampu mendorong bawahan mencari jalan pemecahan permasalahan yang dihadapi; - Mau belajar sepanjang hidupnya, mau bergaul dengan bawahan, dan mapu memobilitas bawahan. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100%

61 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

62 Pertemuan 8 1. Pokok Bahasan; Ujian Tengah Semester 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar; - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran; 5. Informasi pendukung; - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi BAHRUL YANG MENCLA-MENCEL DAN IBU MINA YANG TAMPERAMENTAL Pagi hari yang cerah di ruang kuliah sudah diwarnai bincang-bincang beberapa orang mahasiswa yang sedang menunggu kedatangan Ibu Mina Dosen Mata Kuliah Kepemimpinan. Seperti biasa Ibu mina agak sedikit terlambat datang ke kelas tanpa alasan yang jelas, karena beliau tidak pernah memberitahukan ketika masuk ke dalam kelas. Perbincangan sangat seru tema

63 pembicaraan berkisar diantara kurang tegasnya dan tidak adilnya perlakuan ketua himpunan mereka. Hal ini dapat diidentifikasi dari beberapa kejadian yang mengindikasikan kearah sana. “Aku tidak suka sebenarnya terhadap apa yang dilakukan oleh si Bahrul, mencla-mencle seperti itu harusnya dia lebih tegas bahwa anak-anak yang tidak mengikuti kegiatan pengabdian masyarakat juga harus menyumbang uang, Heni berkata sambil meminta dukungan Yance teman bicaranya. Iya, kemaren begini sekarang begitu keputusan apa itu, kaya orang engga punya pendirian saja! Linda menimpali dari belakang. Kekhawatiran seperti itu sering terjadi semenjak kepengurusan Bahrul yang sering merombak susunan pengurus himpunan, dalam empat bulan berjalan dia sudah dua kali merubah beberapa orang pengurusnya, yang menurut dia pengurus yang dipecat itu kurang becus dalam bekerja. Dari pada diisi oleh orang yang tidak bisa bekerja lebih baik diganti saja dengan orang yang mau bekerja. Tapi belakangan banyak mahasiswa yang tidak setuju dengan pergantian yang terjadi, karena diindikasikan pengurus yang baru adalah lebih pada teman dekatnya, teman satu daerahnya, teman satu kostnya. Hal lainnya bahwa pergantian yang terjadi tidak melibatkan secara keseluruhan anggota himpunan dan wakil-wakil dari tiap angkatan. Pada akhirnya banyak kegiatan yang berhasil versi ketua dan tidak berhasil versi anggota. Mahasiswa menjadi terkotak-kotak kedalam angkatan bukan lagi anggota himpunan. Banyak mahasiswa memboikot kegiatan-kegiatan himpunan, dan banyak indikasi lainnya karena tidak senang dengan kepemimpinan Bahrul. Beberapa saat kemudian di sela riuh rendahnya perbincangan, gebrak suara meja dengan keras di pukul orang didepan, ternyata Ibu dosen sudah datang. “Ribut saja, mahasiswa macam apa kalian ini apakah tidak ada pekerjaan yang lebih baik dari pada ribut! Membaca, menulis berdiskusi akan lebih bermanfaat dari pada ribut seperti ini”. Begitu beliau selalu membuka pelajaran. “Kalau tidak ada perubahan selama satu semester ini, maka semua nilai akan saya beri nilai BL dan Gagal, silahkan anda mengulang semuanya.” Katanya sambil mengeluarkan sejumlah buku dari tas. Tugas : 1. Ujian Tengah Semester 2. Baca dengan baik kasus diatas, kemudian kerjakan perintah di bawah ini secara individual diketik rapih. 3. Model kepemimpinan apa yang dijalankan oleh Bahrul, jelaskan? 4. Apa yang tidak dimiliki oleh Bahrul sebagai Ketua Himpunan, sehingga terjadi konflik diantara anggotanya? 5. Bagaimana kepemimpinan Bahrul untuk jangka pendek, berhasil atau tidak jelaskan? 6. Apa yang harus dilakukan dengan cepat oleh Bahrul supaya kepemimpinan yang dijalankannya mendapat dukungan dari teman-temannya? 9. Respon atau balikan terhadap hasil evaluasi

64 Pertemuan 9 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Konflik adalah segala macam interaksi pertentangan atau antogonistik antara dua atau lebih pihak. Pertentangan kepentingan ini berbeda dalam intensitasnya tergantung pada sarana yang dipakai. Masing-masing ingin membela nilai-nilai yang telah mereka anggap benar, dan memaksa pihak lain untuk mengakui nilai-nilai tersebut baik secara halus maupun keras. Jenis-jenis konflik : a) Konflik peranan yang terjadi di dalam diri seseorang (personale conflict), dimana peraturan yang berlaku tak dapat diterima oleh seseorang sehingga orang itu memilih untuk tidak melaksanakan sesuatu sesuai dengan peraturan yang berlaku tersebut. b) Konflik antarperan (interrole conflict), dimana orang menghadapi persoalan karena dia menjabat dua atau lebih fungsi yang saling bertentangan; anggota serikat pekerja yang sekaligus sebagai mandor perusahaan. c) Konflik yang timbul karena seseorang harus memenuhi harapan beberapa orang (intersender conflict), misalnya saja dekan suatu

65 fakultas harus memenuhi permintaan yang berlainan para ketua jurusan. d) Konflik yang timbul karena disampaikannya informasi yang saling bertentangan (intrasender conflict). Konfik tidak selamanya menyusahkan akan tetapi memiliki segi-segi positif, seperti : 1) Konflik Dalam : - penggantian pimpian yang lebih berwibawa, penuh ide baru, dan semangat baru; - Perubahan tujuan organisasi yang lebih mencerminkan nilai-nilai yang disesuaikan dengan perubahan situasi dan kondisi; - Pelembagaan konflik itu sendiri, artinya konflik disalurkan agar tidak merusak susunan atau struktur organisasi; dengan demikian konflik tidak dipadamkan akan tetapi dilahirkan sesuai dengan kehendak anggota sehingga tercipta tata susunan baru peraturan permainan dalam organisasi. 2) Konflik dengan organisasi lain : - lebih mempersatukan para anggota organisasi - mendatangkan kehidupan baru di dalam tujuan serta nilai organisasi - lebih menyadarkan para anggota terhadap strategi serta taktik lawan; - sebagai suatu lembaga pengawasan. Sumber-sumber Konflik Organisasi 1. Kebutuhan untuk membagi sumberdaya-sumber daya yang terbatas 2. Perbedaan-perbedaan dalam berbagai tujuan. 3. Saling ketergantungan kegiatan-kegiatan kerja 4. Perbedaan nilai-nilai atau persepsi 5. Kemenduaan organisasional (ambiguous ; tanggungjawab yang mendua). 6. Gaya-gaya individual Konflik Antarpribadi - Aspek-aspek konflik antarpribadi atau antarindividu merupakan suatu dinamika penting perilaku organisasional

66 - Jendela Johari, untuk menganalisa dinamika interaksi antara seseorang dengan orang lain Orang mengenal orang lain Orang tidak mengenal orang lain Orang mengenal dirinya sendiri 1 Pribadi terbuka 2 Pribadi tersembunyi Orang tidak mengenal dirinya sendiri 3 Pribadi buta 4 Pribadi tak dikenal 1. Open self, orang mengenal dirinya sendiri dan orang lain 2. Hidden self, orang mengenal dirinya sendiri tapi tidak mengenal pribadi orang lain 3. Blind self, orang mengenal pribadi orang lain tetapi tidak mengenal dirinya sendiri 4. Undiscovered self, orang tidak mengenal dirinya sendiri dan orang lain. - Tujuh pedoman bagi pengadaan umpan balik untuk hubungan antarpribadi yang efektif : 1) Menjadi lebih deskriptif daripada bersifat pertimbangan 2) Menjadi lebih spesifik daripada umum 3) Menangani hal-hal yang dapat dirubah 4) Memberikan umpan balik bila diinginkan 5) Memperhatikan motif-motif pemberian dan penerimaan umpan balik 6) Memberikan umpan balik pada saat penerimaan berlangsung 7) Memberikan umpan balik bila akurasinya dapat dicek dengan orang-orang lain. - Strategi penyelesaian konflik antarpribadi 1) Lose – lose approach, kedua belah fihak dalam konflik kalah. 2) Win – lose approach, menang untuk mengalahkan.

67 3) Win – win approach, memenangkan keduabelah fihak dilihat dari sudut pandang manusiawi dan organisasional. Konflik Organisasional - Konflik Struktural 1) Konflik Hirarkis Konflik antar berbagai tingkatan organisasi. 2) Konflik Fungsional Konflik antar berbagai departemen fungsional organisasi. 3) Konflik Lini-Staf Konflik antara lini dan staf. 4) Konflik Formal Informal Konflik antara organisasi formal dan informal - Peranan Konflik dalam organisasi 1) Konflik tidak dapat dihindarkan; 2) Konflik ditentukan oleh faktor-faktor struktural seperti bentuk fisik suatu bangunan, desain suatu struktur karier, atau sifat sistem kelas; 3) Konflik adalah bagian integral sifat perubahan; 4) Konflik dapat membantu atau menghambat pelaksanaan kegiatan-kegiatan organisasi dalam berbagai derajat; 5) Tingkat konflik minimal adalah optimal; 6) Konflik dan Prestasi Organisasional Kegagalan karena perpecahan Tinggi Tinggi Kegagalan karena stagnasi Tingkat Optimal Konflik Konflik Organisasional Prestasi Organisasi

68 Menyelesaikan konflik 1) Menggunakan kekuasaan 2) Konfrontasi 3) Kompromi 4) Menhaluskan situasi 5) Pengunduran diri  Konflik adalah : Oposisi, interaksi yang antagonostis atau bertentangan, berbenturan antara macam-macam paham, perselisihan, kurang mufakat, pergesekan, perkelahian, perlawanan dengan senjata dan perang.  Konflik dalam pengertian negatif Berkaitan dengan sifat-sifat animalistik, kebuasan, kekerasan, barbarisme, destruksi/pengrusakan, penghancuran, irrasionalisme, tanpa kontrol emosional, huru-hara, pemogokan, perang, dan lain-lain.  Konflik dalam pengertian positif Berkaitan dengan peristiwa petualangan, hal-hal baru, inovasi, pembersihan, pemurnian, pembaharuan, penerangan batin, kreasi, pertumbuhan, perkembangan, rasionalitas yang dialektis, mawas diri, perubahan dan sebagainya.  Antecedent conditions and the stages of conflict in organizations Antecedent conditions create the potential for conflict Role ambiguities Resources scarcities Task Interdependencies Competing objectives Structural differentiation Unresolved prior conflict Perceived conflict Actual conflict Felt conflict Conflict resolution or suppression Conflict aftermath

69  Pendekatan Pemimpin pada konflik : - Pendekatan Pemimpin yang Tradisional 1. Konflik itu sifatnya negatif, destruktif, merugikan 2. Menghindari konflik serta perselisihan 3. Adaptasi diri (penyesuaian diri) dengan prinsip anti konflik 4. Sekolah-sekolah tradisional juga mencerminkan adanya keluarga paternalistis, guru ditampilkan dalam sosok “mahluk maha besar dan kuasa”, patutu “digugu” dipercaya dan ditiru. - Pendekatanan Pemimpin yang “Behavioral” atau Netral 1. Konflik sebagai ciri hakiki tingkah laku manusia yang berkembang sebagai “built-in element”. 2. Konflik bersumber dari perbedaan kodrati masing-masing individu atau kelompok. 3. Peristiwa konflik dalam bentuk macam-macam perbedaan, aneka tujuan, kompetisi, persaingan dan rivalitas. 4. Rasionalisir konflik, dengan tujuan untuk mengurung, membatasi, dan menjinakan konflik sebagai unsur “netral” atau unsur “tidak berbahaya. - Pendekatan Pemimpin yang Modern atau Intraksionistis/Intraksional. 1. Konflik itu penting dan prlu dalam kehidupan. 2. Secara eksplisit konflik itu merangsang oposisi. 3. Orang harus mengmbangkan manajemen konflik, menstimulir konflik; dan harus bisa memecahkannya dengan bantuan manajemen konflik. 4. Manajemen konflik merupakan tanggungjawab pimpinan.  Teknik Merangsang Timbunya Konflik Seni mengelola Konflik : 1. Membuat standar-standar penilaian 2. Menemukan masalah-masalah kontroversial dan konflik-konflik 3. Menganlisa situasi dan mengadakan evaluasi terhadap konflik 4. Memilih tindakan-tindakan yang tepat untuk melakukan koreksi terhadap penyimpangan dan kesalahan-kesalahan

70 5. Teknik-teknik untuk menstimulir konflik - Komunikasi diputuskan atau dikacaukan - Mengacau struktur organisasi - Menempatkan orang-orang yang neurotis ringan dan mempunyai banyak masalah batin menjadi tenaga pemimpin. Maka seni manajemen-konflik dengan jalan : 1. Menstimulir/merangsang konflik 2. Mengendalikan, sekaligus 3. Menyelesaikan secara sistematis tanpa menimbulkan banyak korban dan kesusahan, merupakan determinan (faktor penentu) yang paling gawat-kritis bagi suksesnya pemimpin.  Alat-alat bagi Manajemen Konflik 1. Memecahkan masalah melalui sikap koopertaif Duduk bersama, berunding dan bermusyawarah, melihat masalahnya dengan kepala dingin dan mendiskusikannya, melalui sikap kooperatif orang berusaha melepaskan perbedaan-perbedaan yang tidak prinsipil, tidak selalu mau menang sendiri, dan mengharuskan pihak lain mengalah. 2. Mempersatukan tujuan Tujuan yang dipersatukan itu sama dengan tujuan bersama yang harus dicapai oleh orang-orang dan kelompok. 3. Menghindari konflik Menjauhkan diri dari clash atau benturan terbuka. 4. Ekspansi dari sumber energi Memperbesar sumber-sumber energi atau “kuenya’ supaya pembagian hasil menjadi lebih besar. 5. Memperhalus konflik Mengecilkan perbedaan-perbedaan sikap dan ide dari perorangan dan kelompok yang tengah bertikai, dan memperbesar titik persamaan ataau titik singgung dari tujuan/kepentingan bersama. 6. Kompromi

71 Proses saling berjanji, dengan mana kedua belah pihak bersedia melepaskan sebagian dari tuntutannya. 7. Tidakan yang otoriter Tindakan-tindakan yang tegas dan drastis di saat-saat genting. 8. Mengubah struktur individual dan struktur organisasi 9. Memindahkan dan mempertukarkan anggota-anggota kelompok dan pemimpinnya, membnetuk badan koordinasi, memperkenalkan sistem konsultasi, memperluas partisiasi aktif para anggota. 5. Informasi pendukung - SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. - SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. - SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Basis kekuasaan yang menggunakan perilaku, tata nilai yang dibentuk dan norma-norma pisitf yang melekat pada diri sendiri sebagai kebiasaan dan pandangan orang lain termasuk ke dalam basis kekuasaan : - Coercive - Reference - Information - Reward Kemampuan pemimpin untuk dapat memfasilitasi perubahan dengan kepemilikan visi dan misi organisasi yang harus dimiliki oleh setiap orang adalah pimpinan dengan gaya : - Succesfull - Colaborative - Transformational - Democrative Kepala Sekolah adalah “Key Person” di sekolah, kata yang tercetak tebal memiliki pengertian seperti di bawah ini kecuali : - Pengambil keputusan - Pemimpin sekolah - Penerus kekuasaan

72 - Pengemban visi sekolah Kekuasaan seorang pemimpin dibatasi oleh variable-variabel kemanusiaan dan variable-variabel yang melekat pada jabatannya, pada intinya kekuasaan seorang pemimpin titik akhirnya adalah dalam bentuk : - Kemandirian bawahan - Kecemasan bahawan - Kepatuhan bawahan - Kepuasan bawahan Pemimpin tidak selamanya baik, benar, jurjur dalam perilakunya seperti tuntutan bawahannya, akan tetapi muncul dalam bentuk isitlah pemimpin yang abnormal. Apa yang dimaksud dengan pemimpin abnormal tersebut ? - Pemimpin yang memiliki pandangan masa depan yang luas - Pemimpin yang memiliki kelebihan dibandingkan dengan yang lainnya dan di luar batas-batas penerimaan bawahannya - Pemimpin yang memiliki kelebihan energi pribadinya - Pemimpin yang menggunakan kekuasannya di luar batas-batas kekuasaannya. Salah satu asumsi dari teori X adalah : - Manusia itu malas bekerja; - Manusia tidak memiliki rasa tanggungjawab; - Mengendalikan diri itu penting; - Manusia itu memiliki rasa tanggungjawab. Salah satu asumsi teori Y adalah : - Manusia hanya akan bekerja bila diperintah; - Manusia tidak memiliki rasa tanggungjawab; - Bekerja pada umumnya sama dengan bermain; - Manusia tidak memiliki kemampuan berkreasi. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : - Memberi kepercayaan kepada bawahan; - Membuat tugas dengan jelas dan berstruktur; - Mendorong bawahan untuk berinisiatif; - Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : - Kekuasaan, rasa aman, dan keberhasilan; - Rasa aman, keberhasilan, dan kekuasaan; - Penghargaan, rasa aman, dan afisiasi; - Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; - Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; - Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan.

73 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

74 Pertemuan 10 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Nilai intinya adalah hati, pemimpin yang baik bergerak karena hati tidak semata-mata hanya mengandalkan rasional. Orang yang hatinya tidak bersih tidak akan mampu memunculkan reaksi atau jawaban orang lain, dengan hati yang bersih seorang pemimpin diharapkan dapat berinteraksi dengan masyarakat secara positif, dalam artian dapat mentransfer seluruh persaan-perasaan dan denyut hat i para pemimpin/pendidik (Nana Rukmana: 2007). Kepemimpinan merupakan upaya untuk mendayagunakan segala sumberdaya sekolah untuk mencapai tujuan sekolah. Proses mempengaruhi akan tercapai manakala personil sekolah melakukan kerja sama secara sinergi sebagai sebuah sistem yang kokoh untuk menguatkan kondisi lingkungan internal sekolah, sehingga dapat bersaing dengan berbagai pesaing lainnya, baik itu sekolah lain, dunia industri ataupun yang lainnya. Kepala sekolah berperan untuk menganalisa secara tepat berbagai kondisi lingkungan baik internal maupun eksternal lingkungan sekolahnya. Sehingga bisa melahirkan strategi yang tepat untuk membawa sekolah pada peruabahan yang diharapkan. Kepemimpinan kepala sekolah dapat dilihat dari tiga aspek penting, yaitu karisma pimpinan, kepekaan individual, dan stimulasi intelektual dalam menjalankan kepemimpinannya. Pada sekolah dengan lingkungan yang dinamis,

75 kepemimpinan berjalan dengan dinamis pula. Pada sekolah yang berada pada lingkungan yang stagnan, kurang, lebih senang dengan kondisi kemapanan, kepemimpinan akan berjalan dengan kondisi yang tidak pasti. Dan pada sekolah yang berada pada lingkungan yang tertutup, cenderung menolak perubahan, karena menganggap perubahan sebagai suatu yang merugika, maka kepemimpinan akan berjalan dengan orientasi lingkungan internal sekolah. Sekolah sendiri merupakan suatu sistem yang terbuka (open sistem) yang secara pasti akan dipengaruhi oleh berbagai hal yang berada di luar lingkungannya. Bahkan input sekolah itu sendiri berasal dari masyarakat dan akan kembali kepada masyarakat (Hoy and Miskel, 2001). Kepemimpinan merupakan upaya untuk menggerakkan berbagai sumber daya melalui SDM (sumber daya manusia) untuk mencapai tujuan dan perubahan zaman akan selalu mempengaruhi sasaran-sasaran yang harus dicapai oleh sekolah, karenanya harus diketahui dengan akurat, bagaimana kepala sekolah sebagai pemimpin sekolah yang berada dalam lingkungan sistem terbuka harus memimpin. Kepemimpinan akan melibatkan diri kepala sekolah dan perubahan lingkungan internal dan eksternal sekolah. Pendekatan terhadap kepemimpinan salah satunya dikembangkan oleh Paul Hersey dan Keneth H. Blanchard dengan Contingency Theory (teori situasional) yang mengemukakan bahwa kepemimpinan akan efektif apabila melihat atau memperhatikan kematangan pengikut dan kemampuan untuk menyesuaikan orientasi tugas dengan orienatasi hubungan manusiawi. Dari teori ini lahir 4 (empat) gaya kepemimpinan yaitu Telling (S1) yaitu perilaku pemimpin dengan tugas tinggi dan hubungan rendah. Selling (S2) yaitu perilaku pemimpinan dengan tugas tinggi dan hubungan tinggi. Participating (S3) yaitu perilaku pemimpin dengan hubungan tinggi dengan hubungan rendah, dan Delegating (S4) yaitu perilaku pemimpin dengan hubungan dan tugas rendah. Kepemimpinan akan dipengaruhi oleh banyak faktor, baik pengaruh dari dalam diri pemimpin itu sendiri maupun dari luar dirinya. Pengaruh dari luar pemimpin inipun memiliki dua dimensi, yaitu dimensi internal sekolah dan

76 dimensi eksternal sekolah. Setelah pemahaman trend yang masyarakat bahwa akan memaksa sekolah-sekolah untuk mengembangkan kultur-kultur kerja sama/kolaborasi, tantangan yang paling besar masih menghadapi para pemimpin sekolah benar-benar mentransformasi kultur dari sekolah-sekolah. Pendidik-pendidik dengan sepenuh hati terlibat dalam teknis diskusi tentang kurikulum, penjadwalan, susunan kepegawaian dan fasilitas-fasilitas sebagai bagian dari sesi-sesi perbaikan sekolah. Jujur, diskusi terbuka tentang kultur sekolah, tentang apa yang percaya akan, jarang. Kebanyakan sekolah ubah usaha-usaha sudah tidak mencukupi karena kita tidak mengambil waktu dan resiko itu untuk menguji yayasan/pondasi kultur sekolah. Untuk mengubah budaya, para pemimpin bidang pendidikan harus memahami nilai-nilai inti dan kepercayaan-kepercayaan bahwa menyediakan kedua-duanya arah dan stabilitas. Nilai-nilai inti menyediakan arah dengan bertindak sebagai idaman-idaman dibanding dengan kita mengukur perilaku kita. Nilai-nilai inti menyediakan stabilitas dengan bertindak sebagai kepercayaan-kepercayaan yang tidak berubah berada di pusat suatu sekolah. Banyak sekolah ubah usaha-usaha bahwa berfokus kepada meningkatkan persyaratan-persyaratan wisuda/pembagian derajat, mengubah jadwal-jadwal dan kembangkan distandardisasi menguji dengan sepenuhnya luput/kehilangan sisi yang budaya merancang kembali sekolah-sekolah. Suatu hal positif, budaya kolaboratif adalah jumlahan dari beberapa nilai-nilai inti. nilai Inti budaya yang pertama adalah suatu misi sekolah memfokuskan di pelajaran siswa dan guru. Suatu nilai yang kedua adalah kepercayaan bahwa semua siswa dan staf dapat belajar dan bertumbuh. Suatu kesanggupan untuk menetapkan hubungan-hubungan antar para siswa dan staf bahwa mendukung sasaran milik sekolah tersebut yang bidang pendidikan adalah sepertiga nilai inti. Kepemimpinan dibagi bersama, hubungan-hubungan berdasar pada rasa hormat timbal balik dan mempedulikan, collegialas dan suatu berfokus kepada kinerja dan perbaikan bersifat inti tambahan menilai di suatu budaya yang kolaboratif (Peterson, 1999). Menggunakan Yang Tiga R untuk Kembangkanlah Budaya-budaya Kolaboratif, Kita memandang budaya sebagai satu selimut tidur dengan

77 ruwetnya menenun. Benang/ulir-benang/ulir yang individu tak terbilang yang ditenun bersama-sama mewakili; menunjukkan nilai-nilai inti yang saling tergantung. Jika kita mencoba untuk mendapat suatu pandangan yang lebih baik dari selimut tidur dengan terpisah benang/ulir-benang/ulir itu kepada lihat mereka secara individu, kita tak dapat melihat seluruh selimut tidur. Dengan cara yang sama, jika kita mencoba untuk memahami budaya dengan pemisahan nilai-nilai inti dan memperhatikan masing-masing di dalam pengasingan, kita tak dapat melihat seluruh budaya. Oleh memanfaatkan pendekatan holistic ini, pendidik-pendidik akan mengembangkan suatu budaya yang didasarkan pada ke tiga komponen-komponen utama: menciptakan hubungan-hubungan yang menyembuhkan, keterkaitan dan tanggung jawab. Budaya-budaya sekolah kolaboratif termasuk hubungan-hubungan dan partnerships yang kelihatan, positif di dalam sistim sekolah tersebut dan di luar. Sebagai hasil trend yang membawa kepada abad 21 dan menghasilkan lingkungan bidang pendidikan kompetitif, budaya sekolah harus lebih banyak klien memusat dalam satu usaha untuk memenuhi kebutuhan tentang para siswa yang individu. Hubungan-hubungan berdasar pada kepercayaan-kepercayaan bahwa semua siswa dapat belajar dan para guru bertanggung jawab atas pelajaran siswa bersifat asas di suatu budaya yang kolaboratif. Untuk tinggal kompetitif, pendidik-pendidik akan perlu untuk percaya dan bertindak dalam cara-cara yang bahwa menunjukkan bahwa para siswa adalah di inti usaha-usaha kita. Guru dalam hubungannya dengan siswa yang harus ditandai oleh rasa hormat timbal balik, kerja sama/kolaborasi dan perhatian. Hubungan-hubungan yang menyembuhkan didasarkan pada harapan-harapan tinggi untuk perilaku siswa dan kinerja menggabungkan dengan dukungan tinggi. Secara kebiasaan/tradisional, para guru sudah lakukan mereka memasukkan pengasingan dari dunia di luar sekolah seperti juga di dalam pengasingan yang relatif dari para rekan kerja. Pengajaran perlu berfokus kepada siswa pertemuan yang individu memerlukan dengan mengembangkan hubungan-hubungan ganda untuk mengakses semua tersedia sumber daya. Sekolah-sekolah sering memerlukan para siswa untuk memenuhi kebutuhan tentang organisasi

78 oleh, sebagai contoh, kursus-kursus penawaran hanya pada waktu yang tertentu dan dengan persembahan hanya kursus-kursus yang tertentu. Para siswa memerlukan sering dikesampingkan oleh kebutuhan-kebutuhan organisatoris. Gaya produksi massal ini pendidikan de-personalizes hubungan-hubungan dan memimpin ke arah pengasingan dan konflik yang ditingkatkan antara para guru dan para siswa. Karena tanpa guru yang tunggal dapat temu berbagai kebutuhan-kebutuhan dari suatu kelas dari para siswa, sekolah-sekolah harus mencari hubungan-hubungan dan partnerships baru di dalam dinding sekolah tersebut dan di luar. Para guru yang terbiasa bekerja sendirian harus mengembangkan pola pikir itu untuk mencari-cari peluang mitra dan ketrampilan-ketrampilan itu untuk membuat partnerships yang menyembuhkan bekerja. Hubungan-hubungan yang menyembuhkan adalah suatu komponen int i dari suatu budaya yang kolaboratif. Budaya-budaya sekolah tradisional menghalangi hubungan-hubungan kolaboratif dengan para guru pengasingan dari satu sama lain dan dengan mengembangkan kurangnya rasa hormat antara para guru dan para siswa. Sekolah-sekolah yang merasa terikat dengan mengembangkan hubungan-hubungan yang menyembuhkan mendorong para guru dan para siswa untuk bekerja sama/berkhianat satu sama lain seperti juga dengan para mitra eksternal. Sebagai suatu komponen inti dari budaya, keterkaitan, mengingatkan kita bahwa apa yang kita merusak sekolah-sekolah harus penuh arti dan berguna bagi kedua-duanya para siswa dan masyarakat. Suatu hal positif, budaya kolaboratif ditandai oleh pekerjaan bahwa memotivasi para siswa karena bahwa pekerjaan adalah relevan. Sifat yang sinis, kinerja siswa lemah/miskin, hubungan-hubungan tegang dan pengasingan dari sekolah adalah gejala-gejala dari suatu pengalaman bidang pendidikan yang tidak relevan dan suatu budaya sekolah yang dirusakkan. Suatu budaya yang menyembuhkan mendorong para guru, para pemberi kerja, para siswa, orang tua dan masyarakat itu untuk bekerja sama untuk menciptakan pelajaran penuh arti mengalami untuk para siswa. Sekolah-sekolah tidak bisa berkembang relevan, pelajaran penuh arti mengalami untuk para siswa di dalam biakan tertutup. Suatu budaya yang

79 kolaboratif bahwa memeluk; menganut dunia di luar sekolah tersebut adalah perlu sehingga apa yang merusak sekolah berkait dengan para siswa dan untuk masyarakat. Sekolah-sekolah memfokuskan di memenuhi kebutuhan semua siswa percaya bahwa semua siswa dapat belajar ketika belajar mengalami relevan. Komponen yang ketiga dari budaya adalah tanggung jawab, termasuk kedua-duanya tanggung jawab siswa untuk belajar dan tanggung jawab milik sekolah tersebut untuk pelajaran siswa. Di suatu budaya yang menyembuhkan, semua anggota masyarakat itu bersifat bertanggung jawab kepada satu sama lain termasuk siswa kepada para siswa, para guru kepada para siswa, para siswa kepada para guru dan para guru kepada para guru. Suatu budaya berdasar pada tanggung jawab menolak alasan membuat dan menyalahkan game di dalam hubungan antar pribadi. Suatu budaya berdasar pada tanggung jawab menerima standard tinggi untuk perilaku dan kinerja kombinasikan dengan dukungan yang dermawan. Masing-masing individu menerima tanggung jawab untuk tindakan-tindakan dengan dukungan yang penuh dari orang lain. Sebagai contoh, jika suatu aturan kelas dilanggar pelanggar menerima tanggung jawab kedua-duanya karena tindakan-tindakan mereka dan karena memperbaiki setiap kejahatan yang dilaksanakan kepada hubungan-hubungan. Memimpin dengan nilai adalah memimpin dengan hati, perhatikan syair berikut dari Abuya Syeikh Imam Ashari Muhammad At Tamimi: Susahnya menjaga hati, sedangkan ia adalah pandangan Tuhan Ia merupakan wadah rebutan di antara malaikat dan syaitan Masing-masing ingin mengisi, malaikat dengan hidayah, syaitan dengan kekufuran Bila tiada hidayah, ilmupun tidak menjamin, sekalipun ia perlu Susahnya menjaga hati, bila dipuji ia berbunga terasa luar biasa Bila di caci aduh sakitnya, Pencaci mencaci dibenci bahkan dendam sampai mati Bila berilmu atau kaya, sombong mengisi dada Jika miskin atau kurang ilmu, rendah diri pula dengan manusia Adakalnya kecewa, puncaknya putus asa Takdir yang menimpa susah untuk reda Ujian yang datang sabar dada, jiwa menderita Kelebihan orang lain hati tersiksa kesusahan orang lain hati menghina bahkan terhibur pula Menegur orang suka, ditegur hati luka

80 Aduh susahnya menjaga hati patutlah ia dikatakan raja diri Bukankan sifat sombong pakaian raja? Proses pendidikan adalah sebuah upaya untuk menghasilkan generasi muda penerus kehidupan bangsa dan umat manusia yang cerdas, terampil, memahami perubahan dan yang terpenting adalah memiliki moral dengan pijakan nilai dan norma agama serta nilai norma kehidupan yang kuat. Upaya mencerdaskan kehidupan bangsa ini merupakan tanggungjawab bersama, dimana pendidikan diselenggarakan dan diawasi bersama, dalam arti kata menjadi tanggungjawab bersama. Bagaimanapun mencerdaskan masyarakat ini tidak bisa bergantung pada salah satu kelompok orang saja apalagi hanya bergantung pada satu orang, di sekolah tidak hanya guru atau kepela sekolah saja, akan tetapi guru, kepala sekolah, dan anggota lainnya bahkan masyarakat bersama-sama bertanggungjawab atas terselenggarannya pendidikan yang baik, bermutu dan dapat menghasilkan generasi penerus bangsa yang cerdas, terampil, dan yang terpenting memiliki hati nurani yang baik, berbudi pekerti yang luhur dengan keimanan dan ketaqwaan yang tinggi. Walaupun demikian, mekanisme manajemen yang baik menghendaki adanya satu rentang kendali yang jelas dan utuh untuk dapat mewujudkan tujuan tersebut. Dalam pelaksanaan manajemen pendidikan, dibutuhkan satu rentang kendali yang utuh dari satu pucuk pimpinan sehingga operasi manajemen dapat berjaan dengan baik sesuai dengan fungsinya masing-masing. Pemimpin adalah kendali utama terselenggaranya proses dan tercapainya tujuan, karena bagaimanapun ketika banyak kendali akan menyebabkan runtuhnya koordinasi dan akan mengakibatkan manajemen tidak dapat berjalan dengan baik serta memungkinkan adanya dualisme dalam pencapaian tujuan. Hal penting dalam kajian penelitian ini adalah kendali utama itu dilandasi oleh satu pondasi yang kuat dimana nilai dan norma dasar sebagai basis value pemimpin dalam menjalankan peranannya. Nilai dan norma individu pemimpin harus bernjak dari nilai norma pribadi yang utuh dan dari nilai dan norma umum yang disepakati bersama dan dibawa kedalam organisasi. Dalam peranan yang berbeda sekalipun, ketika semangat spiritualisme pemimpimpin itu menjadi

81 pondasi dasar kepemimpinannya maka tidak akan mengaburkan setiap peranan yang harus diperankannya. Bahwa memang benar para pemimpin mengasumsikan beraneka peran dalam menjalankan kepemimpinanya. Untuk dapat menilai dan meletakan fungsinya dalam beragam situasi, maka sejumlah pilihan untuk dapat menjalankan tugasnya sebagai pemimpin harus dimiliki (visi), para pemimpin yang efektif adalah orang yang mampu merangkul dan menggerakan anggota intern (seluruh anggota sekolah) dan kelompok masyarakat eksternal organisasi sehingga mampu menjalankan kepemimpinannya dari suatu situasi atau suatu peran kepada suatu cakupan dari tindakan-tindakannya. Cakupan yang luas dengan visi yang tajam membawa organisasi sekolah kearah tujuan yang diharapkan bersama bukan hanya harapan warga sekolah akan tetapi masyarakat juga akan terakomodasikan dengan baik. Adapun yang dimaksudkan dengan nilai (values), seperti dikatakan oleh Azim Premzi adalah sebagai berikut (2007): What do I mean by values? Let me share with you a few values that have a lot of meaning for me. They are by no means comprehensive, but I hope they will help you in defining your own values. First is the value of honesty. You have to be completely honest not only with other people but also with yourself. Honesty in many ways is synonymous with integrity. It builds transparency. Once people know you are honest, they start respecting you for what you are. In the long run this makes for a stronger relationship. Second is the value of hard work. We need to become a nation of hard workers. It was not resources but hard work that transformed other nations such as Japan, after being completely devastated after World War II. Steady work builds up both wealth and power and keeps one's conscience in rectitude. We need to work hard and work smart. We have to change from our image of India from being a nation of holidays to a nation of people who enjoy hard work. Third is the value of self-confidence. Centuries of subjugation have made us embrace a fatalistic approach to life. But that is all in the past. The millennium of the mind has altered the entire landscape of competitive advantage. India has one of the largest pools of disciplined, technical talent. They have won enormous respect from nations all over the world, whether it is in information technology, scientific research or in academia. Self-confidence has to be an intrinsic part of our approach in demanding what is due for our merit and ability and not undersell ourselves to the outside world, no matter what our internal competitive compulsions may

82 be. The truth is that nobody can make us feel inferior without our consent. The fourth value is humility. Humility is not opposed to self-confidence. In fact, though it might seem like a paradox, people with the highest self-confidence have the highest humility, because they have nothing to prove to themselves. Humility is a pre-requisite for continuous learning from the environment. No matter how good you are, someone out there knows how to do things a little better. Technology keeps changing and standards of excellence keep getting upgraded. If we have humility, we can have an open mind to absorb the changes. Remember, the mind is like a parachute; it functions only when it is open. The fifth value is persistence. There are enough stories of people who gave up their search for gold and stopped digging just a few feet way from the gold ore deposit. Nothing is ever achieved in one go. One has to keep at it irrespective of the initial setbacks and frustration. You owe it to yourself to make that one more try that could make all the difference. The last value is passion in whatever you do. Passion is giving your 100 per cent to whatever you take up. Passion requires that you own up whatever you take up, no matter how small or seemingly unimportant. Nilai sebagai bentuk perilaku kehangatan yang diperlihatkan oleh seseorang dalam hal ini kepala sekolah bagi semua warganya, dengan kehangatan akan memunculkan saling keterbukaan, rasa hormat dan akan membina hubungan yang baik. Nilai adalah bekeraja keras, sebelum kita berserah maka sudah semestinya kita mengupayakan yang terbaik. Baru ketika tugas dan tanggungjawab dilaksanakan maka kita bersrah atas apa yang kita lakukan. Nilai adalah percaya diri, percaya diri akan membawa kita untuk selalau optimis dengan apa yang akan kita lakukan dan hasil yang akan dicapai. Nilai adalah rendah hati, pikiran akan berfungsi ketika dipergunakan dan penggunaannya akan baik ketika kita memiliki kerendahan hati untuk menerima apapun sebagai upaya perbaikan, terutama bagi organisasi. Nilai juga sebagai sebuah ketekunan, sedikit demi sedikit lama-lama menjadi bukit, awalnya tidak mampu bila kita memiliki ketekunan maka kemampuan itu akan kita peroleh dengan baik. Nilai seperti dikemukakan di atas sangat dibutuhkan oleh seseorang yang menjadi pemimpin. Oleh karena itu Sangat penting membagi nilai-nilai sebagai pondasi utama dalam membangun hubungan antar manusia dalam sebuah institusi (sekolah),

83 bahkan dalam satu kegiatan pekerjaan. Organsasi membutuhkan norma dan nilai. Jika organisasi tidak membagi norma dan nilai, maka organisasi tidak akan berkembang dengan baik dalam kinerja dan produktivitasnya dari orang-orang yang ada di dalamnya dan akan memunculkan ketakutan diberhentikan dari pekerjaan atau menggunakan insentif uang dalam memotivasi bawahan untuk bekerja. Nilai menyediakan alasan untuk mempercayai dalam kehidupan sehari-hari; norma sebagai petunjuk perilaku, interaksi dan komunikasi diantara manusia. Nilai membagi tujuan untuk bersama, kepercayaan, cita-cita, dan tujuan-tujuan dalam kelompok. Nilai akan memunculkan keyakinan di dalam kelompok. Akan tetapi untuk memelihara nilai dalam kelomok, kelompok harus membangun norma dan mempengaruhi perilaku, sikap, dan aktivitas setiap anggota kelompok. Kepemimpinan berbasis nilai adalah satu pendekatan dalam penanaman norma dan nilai dalam pengembangan kelompok yang menjadi petunjuk bagi perilaku orang-orang dalam organisasi. Kepemimpinan berbasis nilai membangun nilai dalam diri setiap individu dan memastikan adanya pembagian nilai bagi seluruh anggota organisasi. Untuk memastikan kepemimpinan berbasis nilai dapat dilakukan, pimpinan harus membangun adanya penerimaan pada setiap bagian dalam organisasi. Artinya bahwa setiap individu dalam organisasi menerima peran-peran kepemimpinan dalam berbagai dimensi, tidak hanya berdasarkan struktur birokrasi yang ada. Pemimpin harus dapat belajar untuk memonitor/mengawasi diri sendiri (self monitoring) untuk setiap sikap dan tingkah laku dalam perannya, meninjau ulang setiap tindakanya, melihat dan merenungkan setiap kritik dan saran memungkinkan untuk berkembang menjadi perilaku nyata dalam organisasi. Dalam prakteknya, kesadaran diri sendiri menjadi lebih sedikit mekanikanya dan lebih wajar diperankan sebagai bagian dari sikap dan perilaku keseharian. Penting bagi para pemimpin untuk dengan sadar mencoba dan melihat diri mereka seperti yang lain melihatnya. Nilai yang dimiliki itu sungguh akan membawakan ketenangan dalam menjalankan kepemimpinannya. Bagi para pemimpin yang efektif akan memiliki rasa nyaman dengan nilai-nilai pribadi dan nilai-nilai organisasi yang berkembang. Mereka dapat jujur

84 kepada nilai-nilai sendiri, ketika membantu anggotanya mengartikulasikan apa yang mereka hargai, dan mengambil bagian sebagai suatu pendekatan yang langsung dengan konflik-konflik nilai dalam organisasi. Konsep kepemimpinan berbasis nilai ditapsirkan oleh penulis merupakan sebuah komparasi dari berbagai aspek berkenaan dengan nilai dalam hubungan antar anggota organisasi, kerjasama dengan basis nilai dasar organisasi, komitmen yang tinggi, dan melayani anggota organisasi dengan sepenuh hati. Hal ini sejalan dengan pemikiran dari Peter S. Cohan (1997) mengatakan konsep nilai kepemimpinan sebagai berikut: The concept of Value Leadership arose from a comparison of companies that emerged as Value Leaders when evaluated based on the seven components of the Value Quotient: Value Human Relationships: Treat people with respect so they achieve their full potential consistent with the company’s interests. Foster Teamwork: Get people with different functional skills and responsibilities to work together to advance the interests of the corporation. Experiment Frugally: Harness accidental discoveries to create value for customers and partners. Fulfill Your Commitments: Say what you intend to do, and do what you say. Fight Complacency: Weed out arrogance. Win Through Multiple Means: Use strategy to sustain market leadership. Give to Your Community: Transfer corporate resources to society. Sebenarnya, kepemimpinan berdasar pada nilai bisa bertindak sebagai suatu jangkar yang kuat di dalam organisasi yang “bergolak”. Nilai-nilai menyediakan para pemimpin dengan keberanian itu untuk mengantisipasi setiap problematic yang dihadapi dalam perjalan organisasi. Keinginan yang kuat untuk bergerak didepan kadang-kadang dapat menghancurkan rencana awal yang kemudian memotong jalur, menyudutkan seseorang atau kelompok orang, bahkan dapat mengabaikan aturan-aturan. Bagaimanapun, nilai-nilai itu bagi para pemimpin adalah dasar untuk tidak tersesat dengan kepemimpinannya dan supaya tidak menyesatkan yang utama adalah menyediakan satu disiplin internal yang

85 sangat diperlukan di dalam lingkungan organisasi (sekolah) yang menjadi pegangan semua orang. Jadi sangatlah penting, nilai dasar itu menjadi catatan yang benar untuk sukses dalam organisasi sekolah. Alasannya karena bidang-bidang yang dalam nilai akan sama kritis seperti angka-angka yang sulit ketika kita membangun pelanggan, keyakinan guru, siswa, anggota sekolah lainnya dan kastemer eksternal kita dalam memandang masa depan. Maka adalah kritis ketika pemimpin hanya berfokus kepada menciptakan nilai lewat orang lain atau organisasi ketimbang menata dan mengembangkan terlebith dahulu nilai dasar sebagai individunya. Dave Ulrich menyarankan di dalam bukunya bidang-bidang pengukuran kunci adalah: Kemampuan untuk menaikkan keterampilan-keterampilan dan keahlian dan komitmen pegawai. Kemampuan untuk membuat keputusan-keputusan dan mengatur sumber daya yang dimiliki Kemampuan untuk melakukan inovasi Kemampuan untuk mengadakan, memberikan penghargaan, berkembang dan menyimpan dan memelihara potensi terbaik organisasi Penguasaan pasar sekarang dan yang akan datang Ganti-rugi eksekutip yang diikat kepada sasaran yang strategis Mutu proses yang utama Kemampuan untuk menciptakan dan menggunakan pengetahuan yang terus berkembang Hasil-hasil riset dan praktek menunjukkan bahwa organisasi-organisasi yang berbasis nilai lebih dapat bertahan dan berkembang dibanding dengan organisasi yang mengorientasikan tujuannya terutama karena keuntungan-keuntungan yang akan diperolehnya. Sebenarnya, organisasi-organisasi berbasis nilai lebih menguntungkan, sedangkan organisasi yang tidak akan kesulitan dalam menerjemahkan apa yang dimaksudkan dengan keuntungan organisasi. Keuntungan dalam organisasi bukan semata-mata ukurannya adalah pencapaian

86 profit materi yang besar, akan tetapi profit immaterial adalah penghasilan yang akan menjadi modal menjaga kelangsungan hidup dan berkembangnya organisasi. Pengembangan nilai dasar itu harus dimulai dengan menjadi benar pada pemimpinanya terlebih dahulu, menjadi benar kepada nilai-nilai yang dianut dan sudah ditetapkan, dan pada akhirnya memimpin dengan suatu jiwa. Ketika pemimpin melakukannya, berbagai hal dapat terjadi dalam terutama dalam pencapaian tujuan organisasi. Para pemimpin sekolah sering diilustrasikan seperti ahli waris yang menerima warisan dari orang tunya dengan segala kebaikan dan keburukannya, dia harus siap menerima perintah atau kehendak untuk menjalankan dan memelihara wasiat itu,” (Tyack &Hansot, 1981). Kriktik terhadap pendidikan bahwa pemimpin pendidikan hanya bisa melanjutkan tanpa mampu memberikan warna yang berubah dengan inovasi-inovasi yang baik bagi pencapaian tujuan pendidikan. Sedikit pemimpin pendidikan (sekolah) dapat merubah pola-pola yang sudah ada, kalaupun ada masih malu-malu dengan perubahan yang dilakukan, apalagi yang bersifat kolektif sebagai bagian dari usaha untuk mendorong munculnya kebijakan yang lebih besar. Perubahan yang menyeluruh melalui strategi umum oleh pembaharu-pembaharu menuju ke ke arah kepercayaan atas “suatu kekuatan-kekuatan sekolah yang yang ada dan untuk membangun kapasitas dengan mengembangkan suatu kultur yang kolaboratif dari kemajuan berkelanjutan,” (Sergiovanni, 2005), masih berat untuk kepemimpinan pendidikan kita. Teori kepemimpinan kini telah berkembang dengan mengapresiasikan nilai-nilai kehidupan (values) dan kemanusiaan. Vadim kotelnikov (2008) dalam http://www.1000ventures.com/business_guide/crosscuttings/leadership_valuesbased.html mengatakan kepemimpinan berbasis nilai sebagai berikut: Leadership is not limited just to singular measure of effectiveness – it is a multidimensional phenomenon. Values-based leadership is different from other modes in that it includes all the three factors: 1. Effectiveness – measuring the achievement of the objectives 2. Morality – measuring how change affects concerned parties, and 3. Time – measuring the desirability of any goal over the long term Values-based leadership is not simply about style, how-to, following some recipe, or even mastering "the vision thing". Instead, it is about ideas and values. It is about understanding the different and conflicting needs of

87 followers, energizing followers to pursue a goal than they had never thought possible. "In practical business terms, it is about creating conditions under which all followers can perform independently and effectively toward a single objective." Kepemimpinan tanpa menyertakan values adalah sebuah kepemimpinan yang digerakkan oleh ototarianisme belaka. Nilai-nilai inti kehidupan yang telah teruji berlangsung sepanjang zaman adalah Spiritualitas. Spiritualitas, adalah tentang interaksi jiwa kita pada dunia sekitar. Respon yang memengaruhi perilaku kita di mana pun dan dalam kondisi apa pun. Spiritualitas bukanlah segalanya tentang agama. Spiritualitas adalah tentang mengelabirasi intisari dari hubungan kita secara roh dan jiwa dengan Sumber Kebenaran, atau Yang Maha Kuasa yang kita percayai, dan bagaimana kita mengaplikasikannya secara universal kepada semua orang di sekitar kita. Spiritualitas, membantu membangun karakter dalam diri. Termasuk dalam pola kepemimpinan yang kita jalankan. Kepemimpinan yang berbasis spiritualitas, bukan tentang kecerdasan dan keterampilan dalam memimpin belaka, namun juga menjunjung nilai-nilai kebenaran, kejujuran, integritas, kredibilitas, kebijaksanaan, belas kasih, yang membentuk akhlak dan moral diri sendiri dan orang lain. Spiritual Leadership adalah kepemimpinan yang mengedepankan moralitas, kepekaan (sensitivitas), keseimbangan jiwa, kekayaan batin dan etika dalam berinteraksi dengan orang lain. Karakter seorang pemimpin dengan mendasarkan pada spiritualitas seperti dikemukakan oleh Rachmat Ramadhana al Banjari dalam bukunya Prophetic Leadersip (2008) meliputi: Takwa Memiliki Kesehatan Jasmani Shidiq Amanah Tabligh Fathanah Istiqomah Ikhlas Selalu Bersyukur Malu Melakukan Perbuatan Dosa

88 Cerdas Emosional Sabar Optimis Berjiwa Besar Sikap Syaja’ah Perubahan kolektif dalam kepemimpinan dapat terjadi dan dimungkinkan melalui perubahan-perubahan secara individual dalam diri setiap pemimpin untuk mendasarkan kepemimpinannya kepada nilai dan norma. Seperti dikemukan di atas nilai dasar yang harus menjadi karakter seorang pemimpin yang berhasil sebagai individu dan pimpinan organisasi tidak lepas dari nilai spiritual yang Tinggi, Ilahiah dengan mendasarkan pada patokan-patokan nilai dan norma yang turun dalam konteks transenden yang kemudian dipersilahkan untuk diolah dan dikelola oleh manusianya masing-masing sesuai dengan besaran tugas dan tanggungjawabnya dalam organisasi. Perhatikan dialog antara sahabat dengan Nabi Muhammad SAW yang menggambarkan yang menggambarkan seseorang yang utama (pimpinan yang utama): Sahabat : Siapakah orang yang paling utama? Muhammad SAW : “Setiap orang yang hatinya bersih/sehat dan lidahnya berkata benar” Sahabat : Kami dapat mengenali orang yang berkata benar, tetapi bagaimanakan kami mengenali orang yang bersih hatinya/sehat? Muhammad SAW : “Dia adalah orang yang bertaqwa dan suci, tidak mempunyai dosa, tidak mendendam, dan tidak berbuat salah ataupun mempunyai rasa iri dan dengki. Dalam pelaksanaannya, kepemimpinan yang mendasarkan pada satu titik nilai yang Ilahiah setiap tindak dan tanduk dalam perilaku kerja dan hubungan antar manusia yang dijalin menggunakan pedoman etika dalam perspektif agama dan moral. Kedua hal ini yaitu agama dan moral yang membentuk etika kepemimpinan dengan basis nilai yang kuat, seperti digambarkan oleh Nana Rukmana (2007), etika kepemimpinan perspektif nilai dan agama adalah seperti gambar 2.6:

89 Gambar 2.6 Etika Kepemimpinan Perspektif Agama dan Moral (Nana R : 2007) Kepala Sekolah sebagai pemimpin di sekolah dengan mendasarkan kepada etika agama dan moral sikap professional yang muncul diperlihatkan dengan kebanggaan atas kepemimpinan yang dijalankannya dengan dilandasi oleh komitmen personal dan tanggungjawab yang tinggi terhadap kepemimpinan yang dijalankannya, selanjutnya selalu memiliki inisiatif yang baik guna menyelesaikan tugasnya secara tuntas dan bermutu, tidak lupa selalu meningkatkan pengetahuannya dengan terus belajar atas kekurangan-kekurangan yang dirasakannya, menempatkan diri sebagai bagian dari organisasi, jujur, terbuka, loyalitas terhadap pekerjaan dan bawahan tinggi serta terbuka untuk setiap kritik P J A F T AKUNTABILITAS KOMUNIKATIF T R A N S P A R A N PROFESIONAL JUJUR FATHONAH AMANAH TABLIGH ADIL KONSISTEN DISIPLIN SIAP MUNDUR DARI JABATAN MENDAHULUKAN KEPENTINGAN UMUM MENUNAIKAN HAK BAWAHAN REWARD & PUNISMENT PEDULI MENERIMA KOREKSI KOMITMEN INISIATIF KREATIF RENDAH HATI PEMAAF TEGAS MUSYAWARAH SABAR LEMAH LEMBUT CINTA & KASIH SAYANG MEMBIMBING & MEMOTIVASI

90 dan saran yang konstruktif bagi keberhasilan pencapaian tujuan organisasi sekolah. Dalam berbagai referensi banyak disebutkan bahwa ciri pokok kepemimpinan berbasis nilai mengandung tiga unsur pokok, seperti dikemukakan oleh Vadim Kotelnikov dalam Value Based Leadership (2001) bahwa kepemimpinan berbasis nilai di dalamnya mengandung unsur-unsur sebagai berikut: 1) Morality; measuring how cange effect concerd parties, 2) Effectiveness; meassuring the achievement of the objective, dan 3) Time; measuring the desirability of any goals over the long term. Dalam buku lain yaitu Value Based Leadership: 2006 dikatakan bahwa komponen dasar kepemimpinan berbasis nilai mengandung unsur: 1) Morality, 2) Commitment, 3) Productivity. 1. Moralitas Moral diterjemahkan secara umum sebagai keyakinan yang menjadi bagian dari sikap yang bersumber dari batin diterima secara umum baik sebagai perbuatan, sikap, perilaku, kewajiban, budi pekerti, susila dimana tidak hanya berupa penyesuaian-penyesuaian perilaku dengan aturan-aturan yang ada di luar. Moral memberikan arahan kepada perilaku yang mempunyai pertimbangan-pertimbangan baik dan buruk atau dikatakan perilaku bermoral. Dalam kamus Kamus Umum Bahasa Indonesia (Nurudin, 2001) dijelaskan bahwa pengertian moral sebagai ajaran baik-buruk yang diterima umum mengenai perbuatan, sikap, kewajiban, dan sebagainya; akhlak, budi pekerti, susila. Sedangkan bermoral adalah mempunyai pertimbangan baik buruk, berakhlak baik. Hegel mengemukakan bahwa, kebebasan manusia bukan sekedar sikap otonomi batin, melainkan merupakan hakekat seluruh kerangka sosial didalam manusia merealisasikan diri. Ini berarti bahwa kebebasan harus terungkap dalam tiga lembaga yang satu sama lain berhubungan secara dialektis, yaitu: (a) hukum, (b) moralitas individu, dan (c) tatanan sosial moral (“Sittlichkeit”). Hukum mengandung makna bahwa moral tidak hanya realisasi diri tapi bentukan produk-produk hukum yang disepakati, produk-produk itu memelihara moralitas individu sebagai pribadi dan kelompok,

91 interaksinya terjadi pada tatanan sosial dimana moral membentuk mekanisme kehidupan. Lain Hegel lain Kant, Kant melihat moral sebagai sikap batin dan bukan hanya sekedar penyesuaian-penyesuaian dengan luar, pandangan ini melihat moral sebagai sesuatu yang abstrak dan bentukannya muncul dalam bentuk perilaku dalam berinteraksi dengan dunia/lingkungan luar. Hal ini tidak sejalan dengan pendapat hegel, pendapat kant tersebut dianggap terlalu abstrak. Dari pendapat tersebut di atas dapat disimpulkan bahwa moral juga memiliki berbagai jenis seperti dikemukakan oleh Tarumingkeng (2001) merangkum beberapa jenis moral yang dipetik dari berbagai sumber di internet (Tinjauan Ensiklopedi Filsafat), antara lain: (1) moral realism (moral berdasarkan kondisi yang nyata/realitas); (2) moral luck (moral yang dipengaruhi oleh faktor keberuntungan), (3) moral relativitism (moral yang bersifat relatif), (4) moral rational (moral berdasarkan penggunaan akal sehat atau prosedur rasional), (5) moral scepticism (moral yang menunjukkan sikap ragu-ragu karena tidak memberikan penilaian berdasarkan pengetahun), dan (6) moral personhood (moral yang ditentukan berdasarkan kesadaran, perasaan dan tindakan pribadi atau merupakan bagian dari moral masyarakat. Moral masyarakat menyangkut semua yang memerlukan pertimbangan moral dalam hal-hak dan kewajiban). Kepala sekolah sebagai individu harus memiliki keyakinan sebagai sikap diri, sehingga pada saat dia menjalankan kepemimpinannya akan berupaya untuk menyesuaikan dengan keadaan luar dirinya sebagai bentuk kebermoralan sebagai seorang individu yang pada akhirnya akan mengemas tugas dan tanggungjawabnya sebagai seorang pemimpin. Sikap bisa kita artikan sebagai kecenderungan reaksi penilaian terhadap segala sesuatu di dunia ini. Bisa saja sesuatu itu orang lain, peristiwa atau masalah, ide-ide maupun suatu keadaan fisik. Di dalam sikap terkandung aspek afeksi (emosi atau perasaan), aspek kognisi (keyakinan), dan aspek perilaku (perilaku dalam bentuk nyata ataupun kecenderungan berperilaku). Sebagai kepala sekolah diharapkan bahwa kategori dalam moral dia masuk ke dalam moral

92 personhood dimana moral kepala sekolah ditentukan berdasarkan kesadaran, perasaan dan tindakan pribadi atau merupakan bagian dari moral masyarakat. Moral masyarakat menyangkut semua yang memerlukan pertimbangan moral dalam hal-hak dan kewajiban. Sikap yang dimiliki oleh kepala sekolah mengandung aspek-aspek afeksi dimana muncul emosi diseimabangkan oleh perasaaan dan keyakinan akan kebenaran dan kecenderungan-kecenderurangan yang mencerminkan pola hidup yang bergama, bermasyarakat, dan berorganisasi. 2. Komitmen Banyak orang berkata saya sudah berkomitmen, saya memiliki komitmen yang tinggi, mana komitmen kita bersama. Apa benar komitmen hanya cukup diucapkan saja? Atau komitmen itu sebuah bentuk kata yang membutuhkan pembuktian lainnya? Klaim seperti ini biasanya muncul hanya dalam bentuk bahasa verbal yang perlu kita buktikan dengan tindakan yang yang nyata? Komitmen dapat terlihat dari sejumlah pertanyaan berikut ini: What Should? Apa yang seharusnya dilakukan oleh orang atau pimpinan sesuai dengan tugas dan tanggungjawabnya dalam organisasi. What Could? Apa yang dapat dilakukan oleh orang atau pimpinan dengan kewenangan dan sumber daya yang dimilikinya. What Be? Apa yang dilakukan sebenarnya oleh orang atau pimpinan dalam menjalankan tugas dan tanggungjawabnya. Ketiga pertanyaan tersebut membawa kita untuk dapat melihat seberapa serius, disiplin dan tanggungjawab seorang pemimpin ataupun seseorang dalam menjalankan tanggungjawabnya. Menurut Triguna Priyadarma (2001 : 53) dalam bukunya yang berjudul Kreativitas dan Strategi dikatakan bahwa “Komitmen, yaitu suatu niat yang sungguh-sungguh untuk melaksanakan tugas dan kewajiban, janji atau ucapan, tanpa komitmen mengandung sifat kebohongan yang berakibat menurunkan kepercayan orang lain”. Jadi jelas bahwa komitmen tidak hanya dalam bentuk ucapan saja akan tetapi didalamnya tersirat ada unsur usaha dan waktu yang harus ditempuh seseorang untuk dikatakan dia memiliki komitmen. Richard M. Steers mendefinisikan komitmen organisasi sebagai rasa identifikasi (kepercayaan terhadap nilai-nilai organisasi), keterlibatan (kesediaan

93 untuk berusaha sebaik mungkin demi kepentingan organisasi) dan loyalitas (keinginan untuk tetap menjadi anggota organisasi yang bersangkutan) yang dinyatakan oleh seorang pegawai terhadap organisasinya. Steers berpendapat bahwa komitmen organisasi merupakan kondisi dimana pegawai sangat tertarik terhadap tujuan, nilai-nilai, dan sasaran organisasinya. Komitmen terhadap organisasi artinya lebih dari sekedar keanggotaan formal, karena meliputi sikap menyukai organisasi dan kesediaan untuk mengusahakan tingkat upaya yang tinggi bagi kepentingan organisasi demi pencapaian tujuan. Berdasarkan definisi ini, dalam komitmen organisasi tercakup unsur loyalitas terhadap organisasi, keterlibatan dalam pekerjaan, dan identifikasi terhadap nilai-nilai dan tujuan organisasi Untuk dapat mengukur komitmen seperti disebutkan di atas Agus Darma (1985) dalam bukunya Manajemen Prestasi Kerja; Pedoman Praktis bagi Para Penyelia Untuk Meningkatkan Prestasi Kerja menjelaskan langkah-langkah yang dapat ditempuh seorang pimpinan dalam mengukur komitmen bawahannya, yaitu sebagai berikut : …tujuan utama supervisi adalah untuk memperoleh komitmen bagi keikutsertaan atau keterlibatan dalam apa-apa yang telah dibicarakan. Bila komitmen tidak mungkin diperoleh atau tidak diperlukan, tidak anda menginginkan persetujuan tentang hal-hal yang telah dibicarakan. Persetujuan dan komitmen dapat dibangun melalui penggunaan taktik-taktik berikut : a) ringkasan dan ulangi apa-apa yang telah dibicarakan, b) minta keikutsertaan, c) dengarkan sungguh-sungguh pada saat yang lain telah dikemukakan, d) mintakan pengertian seseorang tentang hal yang telah dikemukakan, e) mintakan persetujuan atau komitmen secara langsung, f) tindak lanjut. 3. Efektivitas dan Produktivitas Soewarno Handayaningrat (1983) menyatakan bahwa : “Efektivitas merupakan pengukuran dalam arti terperincinya sasaran atau tujuan yang telah ditentukan sebelumnya”. Efektivitas diartikan secara umum sebagai ketepatan dalam pencapaian tujuan yang diharapkan, dalam efektivitas mengandung unsur keakuratan atas apa yang direncanakan dengan apa yang dilakukan baik dari sisi input, proses maupun aoutput. Tujuan yang efektif artinya tingkat ketercapaian tujuan seperti yang diharapkan melalui proses-proses yang efektif dan penentuan

94 awal yang tepat (efektif). Kata kunci efektivitas adalah efektif, karena pada akhirnya keberhasilan perusahaan diukur dengan konsep efektivitas. Pengertian efektivitas mempunyai arti yang berbeda bagi setiap orang, tergantung kepada kerangka acuan yang dipakainya. Seorang ahli ekonomi mempunyai persepsi bahwa efektivitas organisasi akan semakna dengan keuntungan atau laba. Bagi instansi pemerintah, efektivitas organisasi semakna dengan program yang mempunyai pengaruh besar dengan kepentingan masyarakat banyak baik politik, ekonomi dan sebagainya Efektivitas melekat pada setiap fungsi-fungsi manajemen dalam prosesnya, efektivitas perencanaan artinya rencana yang dibuat setelah melalui pelbagai proses analisis rencana yang dibuat. Efektivitas pelaksanaan artinya pelaksanaan kegiatan mengikuti standar prosedur yang dibuat sesuai dengan rencana yang ditetapkan. Efektivitas evaluasi artinya alat dan proses evaluasi mengikuti prosedur yang ditetapkan. Efektivitas pencapaian tujuan, artinya bahwa proses pencapaian tujuan dan hasilnya yang dicapai sesuai dengan apa yang direncanakan. Efektivitas memberikan gambaran kepada produktivitas, produktivitas adalah tingkat pencapaian atas segala aktivitas manajemen maupun manusia yang mengoperasikan manajemen. Secara umum, produktivitas diartikan sebagai hubungan antara hasil nyata maupun fisik dengan masukan yang sebenarnya (ILO, 1979). Greenberg yang dikutip oleh Sinungan (1985) mengartikan produktivitas sebagai perbandingan antara totalitas pengeluaran pada waktu tertentu dibagi totalitas masukan selama periode tersebut. Produktivitas diperlihatkan oleh hasil kerja yang dicapai seseorang atau organisasi secara keseluruhan, hasil dari sisi jumlah juga hasil dari sisi kualitas. Orang produktif artinya orang yang mampu menghasilkan sesuatu melebihi kapasitas seperti yang dihasilkan orang lain dan teruji secara kualitasnya. Produktivitas dalam konteks organisasi artinya hasil kolektivitas setiap komponen dalam organisasi, hasil-hasil kerja yang diperoleh oleh setiap orang atau bagian dalam organisasi mengakumulasi menjadi produktivitas dalam organisasi.

95 Organisasi yang tidak produktif artinya organisasi tersebut tidak mampu menghasilkan atau mencapai tujuan seperti yang diharapkan. Dalam konteks persekolahan, efektivitas melekat dalam setiap bidang garapan manajemen sekolah dan fungsi-fungsi manajemen sekolah. Efektivitas dalam pengelolaan kesiswaan, efektivitas pengelolaan kurikulum, efektivitas pengelolaan fasilitas, efektivitas pengelolaan biaya, efektivitas perencanaan, pengorganisasian, penempatan, pengawasaan, dan lain-lain. Produktivitas di sekolah salah satunya digambarkan oleh kemampuan sekolah dalam menghasilkan lulusan dari sisi jumlah maupun mutunya. Produktivitas di sekolah juga ada yang diterjemahkan kemampuan yang dimiliki oleh sekolah dimulai dari kemampuan untuk menghasilkan rencana yang baik, melakukan proses yang sesuai dengan apa yang harus terjadi dan hasil yang diperoleh. Sekolah yang produktif dipengaruhi oleh beberapa faktor yaitu 1) Budaya organisasi, 2) Kepemimpinan sekolah, 3) Kemampuan guru dalam melaksanakan tugas, 4) Kekuatan guru dan siswa serta kekuatan program-program kerja. 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Salah satu kritik terhadap pendekatan sifat kepribadian pemimpin adalah : a) Setiap manusia memiliki kepribadian yang berbeda; b) Sifat-sifat yang dituntut bagi seorang pemimpin bertentangan satu dengan lainnya; c) Tidak ada manusia yang memiliki kepribadian lengkap bagi seorang pemimpin; d) Kepribadian manusia selalu berubah-ubah. Menurut pendekatan sifat kepribadian pemimpin, pendidikan tidak mampu membentuk seorang pemimpin sebab :

96 a. Manusia dilahirkan dengan kepribadian yang unik; b. Kepribadian bersifat tidak dapat dirubah; c. Pendidikan hanya memberikan teori kepemimpinan; d. Kepemimpinan menuntut sifat kepribadian tertentu. Menurut Siagian pemimpin yang berhasil adalah seseorang yang : a. Dilahirkan dengan bakat-bakat kepemimpinan; b. Memperoleh kesempatan mengembangkan bakat kepemimpinannya melalui pendidikan; c. Memiliki pengalaman kerja; d. Dilahirkan dengan bakat-bakat kepemimpinannya melalui pendidikan serta memiliki pengalaman kerja. Dikatakan bahwa satu-satunya hal yang konstan di dunia ini adalah perubahan. Kondisi ini menuntut seorang pemimpin untuk memiliki sifat kepribadian : a. Pendidikan umum yang luas; b. Kemampuan berkembang secara mental; c. Ingin tahu; d. Kemampuan analisis. Adanya fungsi-fungsi yang berbeda, spesialisasi yang semakin beraneka ragam dan kepentingan yang beraneka ragam menunjukan pentingnnya sifat kepribadian : a. Daya ingat yang kuat; c. Keterampilan berkomunikasi; b. Kapasitas integrafik; d. Keterampilan mendidik. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : - Memberi kepercayaan kepada bawahan; - Membuat tugas dengan jelas dan berstruktur; - Mendorong bawahan untuk berinisiatif; - Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : - Kekuasaan, rasa aman, dan keberhasilan; - Rasa aman, keberhasilan, dan kekuasaan; - Penghargaan, rasa aman, dan afisiasi; - Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; - Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; - Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; - Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan. Ciri-ciri pemimpin yang efektif antara lain : - Bersedia melepaskan sebagian wewenangnya kepada bawahan, dan menumbuhkan motivasi bawahan, serta mampu mendorong bawahan mencari jalan pemecahan masalah yang dihadapi; - Senang bergaul dengan bawahan, bersedia melepaskan sebagian wewenangnya kepada bawahan, dan dapat menumbuhkan motivasi bawahan; - Dapat mengidentifikasi staf yang berbakat, bersedia melepaskan wewenangnya kepada bawahan, dan mampu mendorong bawahan mencari jalan pemecahan permasalahan yang dihadapi;

97 - Mau belajar sepanjang hidupnya, mau bergaul dengan bawahan, dan mapu memobilitas bawahan. Tugas kepala sekolah yang paling penting antara lain ; - Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat dan menyempurnakan kurikulum; - Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat, dan mengusahakan timbulnya penghargaan dari murid; - Memelihara hubungan dengan petugas-petugas dari instansi, mengusahakan support dari masyarakat, dan bekerja sama dengan bawahan; - Berpartisipasi dengan masyarakat dalam berbagai kegiatan, bekerjasama dengan atasan, dan memimpin meningkatkan sekolah. 2. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

98 Pertemuan 11 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Teori kepemimpinan situasional dikembangkan oleh Paul Hersey dan Keneth H. Blanchard. Teori kepemimpinan situasional merupakan perkembangan yang mutakhir dari teori kepemimpinan dan merupakan hasil baru dari model kefektifan pemimpin tiga dimensi. Model ini didasarkan pada hubungan garis lengkung atau “curva linier” diantara perilaku tugas dan perilaku hubungan dan kematangan. Teori ini mencoba menyiapkan pemimpin dengan beberapa pengertian mengenai hubungan di antara gaya kepemimpinan yang efetif dan taraf kematangan pengikutnya. Meskipun variabel situasional (pemimpin, pengikut, atasan, organisasi, tuntutan kerja dan waktu) yang terlibat dalam teori kepemimpinan situasional, namun penekanan tetap terletak pada hubngan pemimpin dengan yang dipimpin. Pengikut atau yang dipimpin merupakan faktor yang paling menentukan dalam suatu peristiwa kepemimpinan. Teori ini berasumsi bahwa pemimpin yang efektif tergantung pada taraf kematangan pengikut dan kemampuan pemimpin untuk menyesuaikan orientasinya, baik orientasi tugas ataupun hubungan antar manusia. Makin matang si pengikut, pemimpin harus mengurangi tingkat struktur tugas dan menambah orientasi hubungannya. Pada saat seseorang atau kelompok/pengikut bergerak dan mencapai tingkat rata-rata kematangan, pemimpin harus mengurangi baik hubungannya maupun orientasi tugasnya. Keadaan ini berlangsung sampai pengikut mencapai kematangan penuh, dimana mereka sudah dapat mandiri baik dilihat dari kematangan kerjanya ataupun kematangan psikologinya. Jadi teori situasional ini menekankan pada kesesuaian antara gaya kepemimpinan dengan tingkat kematangan pengikut.

99 Model teori kepemimpinan situasional dilukiskan dengan bentuk kurva seperti lonceng yang melintasi kuadran kepemimpinan seperti yang terlihat pada gambar di bawah ini. Gambar 6.7 Teori Kepemimpinan Situasional Taraf kematangan pengikut terentang dalam satu kontinum dari “immature” ke “maturity”. Semakin dewasa pengikut, semakin matang individu atau kelompok untuk melakukan tugas atau hubungan. Untuk menentukan gaya kepemimpinan yang sesuai pada situasi yang dihadapi pemimpin, pertama-tama harus menetapkan taraf kematangan individu atau kelompok dalam hubungan dengan tugas khususnya yang diharapkan pemimpin untuk mereka selesaikan. Setelah taraf kematangan ini diketahui, gaya kepemimpinan yang cocok dapat ditentukan dengan membuat sudut 90 derajat dari titik pada garis kontinum yang mewakili taraf kematangan pengikut kepada suatu titik yang memotong fungsi garis lengkung kawasan gaya kepemimpinan pada model tersebut. Kuadran dimana perpotongan itu terjadi, menyatakan suatu gaya yang sesuai yang dapat digunakan pemimpin dalam situasi itu. Apabila dengan gaya kepemimpinan tersebut tampak kemampuan pengikut meningkat, maka segera perilaku kepemimpinan berubah menuju ke gaya yang lebih sesuai lagi untuk kemampuan/kematangan tersebut. Hal ini akan terus berlangsung sampai pengikut bisa berdiri sendiri atau mempunyai kemampuan yang tinggi (matang dalam tugas yang dimaksud). Dalam kepemimpinan situasional ini, Hersey dan Blanchard mengemukakan empat gaya kepemimpinan seperti diuraikan di bawah ini. (1) Telling (S1) yaitu perilaku pemimpin dengan tugas tinggi dan hubungan rendah. Gaya ini mempunyai ciri komunikasi satu arah. Pemimpin yang berperan dan mengatakan apa, bagaimana, kapan dan dimana tugas harus dilaksanakan. High Task Behavior High Relationship and Low Task S3 Low Relationship and Low Task S4 High Task and High Relationship S2 High Task and Low Relationship S1 High Low Relationship Behaviior Mature Immature

100 (2) Selling (S2) yaitu perilaku dengan tugas tinggi dan hubungan tinggi. Kebanyakan pengarahan masih dilakukan oleh pimpinan, tetapi sudah mencoba komunikasi dua arah dengan dukungan sosioemosional untuk menawarkan keputusan. (3) Participating (S3) yaitu perilaku hubungan tinggi dan tugas rendah. Pemimpin dan pengikut sama-sama memberikan andil dalam mengambil keputusan melalui komunikasi dua arah dan yang dipimpin cukup mampu dan cukup berpengalaman untuk melaksanakan tugas. (4) Delegating (S4) yaitu perilaku hubungan dan tugas rendah. Gaya ini memberi kesempatan pada yang dipimpin untuk melaksanakan tugas mereka sendiri melalui pendelegasian dan supervisi yang bersifat umum. Yang dipimpin adalah orang yang sudah matang dalam melakukan tugas dan matang pula secara psikologis. 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Berdasarkan teori Managerial Grid, gaya kepemimpinan yang sangat menekankan pada hubungan antar individu tetapi tidak memperdulikan sama sekali produktivitas di sebut gaya kepemimpinan : Team; c. Country Club; Impoverished; d. Task. Teori kepemimpinan yang menggambarkan tipe kepemimpinan otoriter adalah gaya kepemimpinan : Team; c. Country Club; Impoverished; d. Task. Teori kepemimpinan berdasarkan dinamika kelompok mengemukakan bahwa tujuan kelompok dapat digolongkan menjadi dua katagori yaitu : Pencapaian tujuan dan integritas kelompok; Pencapaian tujuan dan pemanfaatan kelompok; Penetapan tujuan dan integritas kelompok; Penetapan tujuan dan integritas kelompok. Jika seorang pemimpin telah memberi kepercayaan kepada bawahan (meskipun tidak sepenuhnya), membuka kesempatan bagi bawahan untuk berpartisipasi, melibatkan bawahan

101 untuk turut serta mengambil keputusan yang begitu penting, dan membuka kesempatan kepada bawahan (meskipun masih ada pembatasan), menurut Rensis Likert, pemimpin tersebut melaksanakan sistem kepemimpinan : Exploitive Authoritative; c. Consultative; Benevolent Authoritative; d. Partisipative. Menurut teori Likert, sistem kepemimpinan yang paling ideal adalah : Exploitive Authoritative; c. Consultative; Benevolent Authoritative; d. Partisipative. Teori dari Tannembaun dan Schmidt bertolak dari konsep demokratis dan otoriter. Dalam kaitan ini Tannembaun dan Schmidt mengemukakan bahwa seorang pemimpin : Hanya dapat mengambil salah satu konsep demokratis atau otoriter; Dapat mengambil kedua konsep tersebut dengan derajat sama tinggi; Dapat mengambil kedua konsep tersebut secara komplementer; Dapat mengambil kedua konsep tersebut tergantung pada situasi. Untuk memilih gaya kepemimpinan yang paling efektif Tannembaun dan Schmidt menyerahkan tiga untuk dipertimbangkan yaitu : Kekuatan diri pemimpin, kekuatan bawahan, dan situasi; Kekuatan diri pemimpin, kekuatan bawahan, dan tujuan; Kekuatan pemimpin, situasi, dan tujuan; Kekuatan bawahan, situasi, dan tujuan. Gaya kepemimpinan kolaboratif menurut Rita Dunn dan Kenenth Dunn adalah gaya kepemimpinan yang baru : Menunjuk adanya keakraban antara pemimpin dengan anggota kelompok; Adanya pembagian kepemimpinan kepada staf; Memberi kesempatan kepada staf untuk memberikan saran atau ide; Mempunyai sedikit ruang gerak bagi staf untuk berperan serta. Getzel dan Guba mengemukakan dua gaya kepemimpinan, yaitu : Normatif dan partisipatif; c. Partisipatif dan personal; Normatif dan personal ; d. Partisipatif dan birokratis. Seorang pemimpin yang berorientasi pada pencapaian tujuan organisasi, menurut Getzels dan Guba, menekankan pada dimensi : Nomotetis; c. Ideografis; Demokratis; d. Autokratis. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

102 Pertemuan 12 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Kepemimpinan yang relevan dengan tuntutan “school based management” dan didambakan bagi produktivitas pendidikan adalah kepemimpinan yang memiliki visi (Visionary Leadership) yaitu kepemimpinan yang kerja pokoknya difokuskan pada rekayasa masa depan yang penuh tantangan, menjadi agen perubahan (agent of change) yang unggul dan menjadi penentu arah organisasi yang tahu prioritas, menjadi pelatih yang profesional dan dapat membimbing personil lainnya ke arah profesionalisme kerja yang diharapkan. Pemimpin yang bervisi merupakan syarat kepimimpinan di era otonomi, dimana organisasi harus menampilkan kekuatan dan ciri khas budayanya menuju kualitas pendidikan yang diharapkan. Konsep Visi Visi tercipta dari kreativitas pikir pemimpin sebagai refleksi profesionalisme dan pengalaman pribadi atau sebagai hasil elaborasi pemikiran mendalam dengan pengikut/personel lain, yaitu berupa ide-ide ideal tentang cita-cita organisasi di masa depan yang ingin diwujudkan bersama. Lee Roy Beach (1993:50) mendefinisikan visi sebagai berikut:" Vision defines the ideal future, perhaps implying retention of the current culture and the activities, or perhaps implying change. (Visi menggambarkan masa depan yang ideal, barangkali menyiratkan ingatan budaya yang sekarang dan aktivitas, atau barangkali menyiratkan perubahan) Terbentuknya visi dipengaruhi oleh pengalaman hidup, pendidikan, pengalaman professional, interaksi dan komunikasi, penemuan keilmuan serta kegiatan intelektual yang membentuk pola piker (mindset) tertentu (Gaffar, 1994:56).

103 Visi merupakan peluru bagi kepemimpinan visioner. Visi berperan dalam menentukan masa depan organisasi apabila diimplementasikan secara komprehensif. Dengan demikian visi terbentuk dari perpaduan antara inspirasi, imajinasi insight, nilai-nilai informasi, pengetahuan dan judgement. Teori Kepemimpinan Visioner Visionary Leadership muncul sebagai respon dari statement “the only thing of permanent is change” yang menuntut pemimpin memiliki kemampuan dalam menentukan arah masa depan melalui visi. Visi merupakan idealisasi pemikiran pemimpin tentang masa depan organisasi yang shared dengan stakeholders dan merupakan kekuatan kunci bagi perubahan organisasi yang menciptakan budaya yang maju dan antisipatif terhadap persaingan global. Benis dan Nanus, (1997:19) mendefinisikan Visi sebagai: “Something that articulates a view of a realistic, credible, attractive future for the organization, a cobndition that is beter in some important ways than what now exists”. Secara umum dapat kita katakan bahwa visi adalah suatu gambaran mengenai masa depan yang kita inginkan bersama. Visionary Leadership didasarkan pada tuntutan perubahan zaman yang meminta dikembangkannya secara intensif peran pendidikan dalam menciptakan sumber daya manusia yang handal bagi pembangunan, sehingga orientasi visi diarahkan pada mewujudkan nilai comparative dan kompetitif peserta didik sebagai pusat perbaikan dan pengembangan sekolah. Kepemimpinan visioner adalah kemampuan pemimpin dalam mencipta, merumuskan, mengkomunikasikan/mensosialisasikan/mentransformasikan dan mengimplementasikan pemikiran-pemikiran ideal yang berasal dari dirinya atau sebagai hasil interaksi sosial diantara anggota organisasi dan stakeholders’ yang diyakini sebagai cita-cita organisasi dimasa depan yang harus diraih atau diwujudkan melalui komitmen semua personil. Agar menjadi pemimpin yang visioner, maka seseorang harus: (a) Memahami Konsep Visi. Visi adalah idealisasi pemikiran tentang masa depan organisasi yang merupakan kekuatan kunci bagi perubahan organisasi yang menciptakan budaya dan perilaku organisasi yang maju dan antisipatif terhadap persaingan global sebagai tantangan zaman. “Visionary leadership” adalah visi kepemimpinan yang harus dimiliki berdasarkan rambu-rambu tersebut di atas untuk mewujudkan sekolah yang bermutu. (b) Memahami Karaktersitik dan Unsur Visi. Suatu visi memiliki karakteristik sebagai berikut: (1) memperjelas arah dan tujuan, mudah dimengerti dan diartikulasikan, (2) mencerminkan cita-cita yang tinggi dan menetapkan standar of excellence, (3) menumbuhkan inspirasi, semangat, kegairahan dan komitmen, (4) menciptakan makna bagi anggota organisasi, (5) merefleksikan keunikan atau keistimewaan organisasi, (6) menyiratkan nilai-nilai yang dijunjung tinggi oleh organisasi, (7) konstektual dalam arti memperhatikan secara seksama hubungan organisasi dengan lingkungan dan sejarah perkembangan organisasi yang bersangkutan.

104 (c) Memahami Tujuan Visi. Visi yang baik memiliki tujuan utama yaitu: (1) memperjelas arah umum perubahan kebijakan organisasi, (2) memotivasi karyawan untuk bertindak dengan arah yang benar, (3) membantu proses mengkoordinasi tindakan-tindakan tertentu dari orang yang berbeda-beda. Langkah-langkah Menjadi Visionary Leadership Visi harus disegarkan sehingga tetap sesuai dan sepadan dengan perubahan-perubahan yang terjadi di lingkungan. Karena itu visi dalam konteks ini merupakan atribut utama seorang pemimpin. Adalah tugas dan tanggungjawab pimpinan untuk melahirkan, memelihara, mengembangkan, menerapkan, dan menyegarkan visi agar tetap memiliki kemampuan untuk memberikan respons yang tepat dan cepat terhadap berbagai permasalahan dan tuntutan yang dihadapi organisasi. Jelaslah bahwa visi itu ternyata berproses, dapat direkayasa dan ditumbuhkembangkan. (a) Penciptaan Visi Visi tercipta dari hasil kreatifitas pikir pemimpin sebagai refleksi profesionalisme dan pengalaman pribadi atau sebagai hasil elaborasi pemikiran mendalam dengan pengikut/personil lain berupa ide-ide ideal tentang cita-cita organisasi di masa depan yang ingin diwujudkan bersama (b) Perumusan Visi Kepemimpinan visioner dalam tugas perumus visi adalah kesadaran akan pentingnya visi dirumuskan dalam statement yang jelas agar menjadi komitmen semua personil dalam mewujudkannya sehingga pemimpin berupaya mengelaborasi informsi, cita-cita, keinginan peribadi dipadukan dengan cita-cita/gagasan personil lain dalam forum komunikasi yang intensif sehingga menghasilkan kristalisasi visi organisasi. Visi perlu dirumuskan dalam statement yang jelas dan tegas dan perumusannya harus melibatkan stakeholders dengan fase kegiatan sebagai beirkut: (1) pembentukan dan perumusan visi oleh anggota tim kepemimpinan (2) merumuskan strategi secara konsensus (3) membulatkan sikap dan tekad sebagai total commitment untuk mewujudkan visi ini menjadi suatu kenyataan. (c) Transformasi Visi Kemampuan membangun kepercayaan melalui komunikasi yang intensif dan efektif sebagai upaya shared vision pada stakeholders, sehingga diperoleh sense of belonging dan sense of ownership (d) Implementasi Visi

105 Implementasi visi merupakan Kemampuan pemimpin dalam menjabarkan dan menterjemahkan visi ke dalam tindakan. Visi merupakan peluru bagi kepemimpinan visioner. Visi berperan dalam menentukan masa depan organisasi apabila diimplementasikan secara komprehensif. Kepemimpinan yang bervisi bekerja dalam empat pilar sebagaimana dikatakan Nanus (2001), yaitu: (1) Penentu Arah, (2) Agen Perubahan, (3) Juru Bicara, (4) Pelatih dan komunikator. Menjadi Seorang Pemimpin yang Visioner dalam Menghasilkan Produktivitas Pendidikan Jika berbicara tentang pendidikan, maka konsep pemikiran kita tidak akan lepas dari suatu wahana dalam menjalankan proses pendidikan, tahapan pelaksanaan pendidikan dan kelompok pendidikan, dimana hal ini dapat diklasifikasikan menurut jalur, jenjang dan jenis pendidikan, yang telah ditetapkan dalam Sistem Pendidikan Nasional. Di era pasar bebas pada abad ke-21 ini, pendidikan harus dapat mengantisipasi berbagai tuntutan. Pertama, sekolah diharapkan dapat menyelenggarakana program yang lebih humanis. Makna humanis dalam hal ini adalah memberi peluang yang lebih besar bagi anggota masyarakat untuk dapat memperoleh manfaat dari penyelenggaraan pendidikan, jaminan mutu pendidikan, menjawab kebutuhan masyarakat, dan biaya pendidikan yang sepadan. Kedua, persaingan tenaga kerja yang mengglobal, yang masuk bersama penanaman modal asing sebagai konsekuensi diberlakukannya perjanjian ASEAN-AFTA (mulai tahun 2002), WTO-GATT dan APEC (mulai tahun 2010). Untuk mengantisipasi hal ini dunia pendidiakan harus mampu menjamin peserta didiknya di berbagai bidang profesi untuk memperoleh sertifikat profesi sebagai syarat untuk memperoleh hak bekerja sesuai dengan kompetensi kepakaran yang dipelajarinya di lembaga pendidikan. Ketiga, pendidikan harus mampu menyiapkan hasil didik yang kompetennya dinilai tidak hanya atas dasar penguasaan pengetahuan dan keterampilan, tetapi juga penguasaan sikap dan semangat kerja, kemampuan berkomunikasi, interpersonal, kepemimpinan, kerja sama tim, analisis permasalahan dan sintetis pemecahan masalah, disiplin, teknologi informasi, pemanfaatan komputer, fleksibilitas kerja, mampu mengelola kekaburan masalah, dapat bekerja dalam berbagai budaya, terlatih dalam etika kerja, serta menguasai bahasa asing sebagai bahasa utama kedua. Keempat, kurikulum sebagai pedoman penyelenggaraan program studi harus dapat menjaga keserasian antara program yang diselenggarakan dengan aspirasi masyarakat dan negara. Kelima, penyelenggaraan pendidikan tinggi diharapkan mampu menampung politisasi pendidikan, kebutuhan belajar sepanjang hayat, internasionalisasi pendidikan tinggi dalam makna reconvergent phase of education. Berdasarkan hal tersebut, agar dapat menciptakan pendidikan yang produktif, maka setiap pemimpin yang melaksanakan tanggungjawabnya harus mampu

106 menetapkan terlebih dahulu visi dalam melaksanakan program kerjanya guna dapat mencapai tujuan yang diharapkan. Visi yang akan ditetapkan, dirumuskan terlebih dahulu dengan melibatkan unsur-unsur yang berkompeten dibidang pendidikan dengan melibatkan stakeholder. Sebelum seorang pemimpin menetapkan Visi, maka pemimpin tersebut perlu mempunyai pengalaman hidup, pendidikan, pengalaman profesional, interaksi dan komunikasi dalam kegiatan intelektual yang membentuk pola pikirnya. Dengan demikian, terciptanya visi terbentuk dari perpaduan antara inspirasi, imajinasi insight, informasi, pengetahuan dan penilaian (judgement). Seorang pemimpin yang mempunyai konsep tentang : 1). bagaimana merekayasa masa depan untuk menciptakan pendidikan yang produktif ; 2). menjadikan dirinya sebagai agen perubahan; 3). memposisikan sebagai penentu arah organisasi; 4). pelatih atau pembimbing yang profesional; 5). mampu menampilkan kekuatan pengetahuan berdasarkan pengalaman profesional dan pendidikannya, dengan didukung oleh ciri khas budaya kerja dalam mencapai tujuannya yang ditetapkan dalam visi dan dijabarkan dalam misi, dapat dikatakan sebagai kepemimpinan yang visioner. Pendidikan dapat dikatakan produktif apabila seorang pemimpin dalam mengelola pendidikannya dapat melakukan efektivitas dan efisiensi yang dalam pelaksanaannya menerapkan 5 konsep tersebut diatas, sehubungan dengan penggunaan sumber daya pendidikan yang tersedia seperti tenaga pendidik atau kependidikan, dana, fasilitas (sarana dan prasarana), dan kompetensi kurikulum agar dapat menghasilkan prestasi yang merata, bermutu, relevan dan mempunyai nilai ekonomi bagi lulusannya, (sesuai keinginan dan harapan yang ditetapkan dalam visi) yang mampu bersaing di dunia kerja sesuai keperluan masyarakat/stakeholder. Oleh karena itu, dalam menghasilkan pendidikan yang produktif dari suatu lembaga pendidikan, seharusnya dipimpin oleh seorang pemimpin yang mempunyai visi atau pandangan jauh kedepan tentang apa yang akan dibutuhkan pasar kerja sesuai dengan perkembangan zaman dan dapat menghasilkan sumber daya manusia yang handal. Gambaran kepemimpinan yang visioner dalam menciptakan pendidikan yang produktif dapat dilihat pada gambar berikut di bawah ini:

107 Gambar 6.8 Kepemimpinan Pendidikan yang Visioner Sifat-sifat seorang visioner, selain dia mampu melihat dan memanfaatkan peluang-peluang di masa depan ia juga memiliki prinsip kepemimpinan seperti yang dikemukakan Stephen R.Covey (1997:27-37) tentang pemimpin yang berprinsip, dengan ciri-ciri sebagai berikut: (a) Selalu belajar (terus menerus) (b) Berorientasi pada pelayanan (c) Memancarkan energi positif (d) Mempercayai orang lain (e) Hidup seimbang (f) Melihat hidup sebagai petualangan (g) Sinergistik (h) Selalu berlatih untuk memperbaharui diri agar mampu mencapai prestasi yang tinggi. Penggunaan Sumber Daya yang Efektif dan Efisien Hasil Lulusan Agent of Change Perekayasa Masa Depan Penentu Arah Organisasi Pelatih dan Pembimbing yang Profesional Menampilkan Kekuatan dan Perubahan Budaya Perubahan Masa Depan SDM yang handal Pendidikan yang Produktif Kesesuaian antara harapan dan kebutuhan PEMIMPIN VISIONER Proses Pendidikan Inovasi

108 Sedangkan produktivitas menurut Thomas (1972), menyatakan bahwa ukuran produktivitas dari suatu lembaga adalah: 1. The Administrator’s production function, mefokuskan pada tatanan lembaga dalam mekanisme kepemimpinan dan manajemen yang memberikan perhatian kepada kepuasan pelanggan, terutama pada peran pemimpin satuan pendidikan dalam memberikan layanan terhadap pelanggan (customer). Semakin banyak dan semakin memuaskan pelayanan yang diberikan lembaga terhadap pelanggan maka semakin produktif lembaga tersebut. 2. The psychologist’s Production Function, menitikberatkan pada perubahan perilaku peserta didik sebagai hsil belajar. Produktivitasnya dapat diukur dari perubahan perilaku siswa, hasil proses belajar mengajar yang memenuhi kebutuhan belajar siswa berdasarka karakteristik dan tugas belajar siswa serta mengembangkan potensi siswa secara menyeluruh. 3. The Economist’s Production Function, adalah mengukur produktivitas dari benefit atau keuntungan yang diperoleh siswa setelah melakukan pengorbanan waktu, tenaga, uang, dan yang lainnya. Pendidikan dalam hal ini sebagai Human Capital. Pendidikan yang produktif adalah pendidikan yang memiliki benefit terhadap individu yang melakukannya berupa kemampuan, keahlian yang relevan dengan kehidupan dan dapat menolong diri dan keluarga dalam kehidupannya. Pendidikan produktif mampu menciptakan keuntungan social sebagai akibat pemahaman seluruh lulusan untuk menciptakan kehidupan yang bermutu dan menguntungkan lingkungan. Seseorang dapat dikatakan sebagai pemimpin yang Visioner dalam menghasilkan pendidikan yang produktif, bila selama melaksanakan tanggungjawabnya sebagai seorang pemimpin dapat mengelola proses pendidikannya yang selalu menciptakan inovasi-inovasi dengan sumber daya yang tersedia (jika memungkinkan mengadakan sumber daya yang baru) telah berhasil menciptakan output yang sesuai dengan visi yang ditetapkan dan berdaya guna menjadi SDM yang handal sesuai dengan harapan atau keinginan stakeholder/pengguna jasa pendidikan, dimana hasilnya dapat menciptakan lulusan yang memiliki benefit terhadap individu yang melakukannya berupa kemampuan, keahlian yang relevan dengan kehidupan dan dapat menolong diri dan keluarga dalam kehidupannya, mampu menciptakan keuntungan social sebagai akibat pemahaman seluruh lulusan untuk menciptakan kehidupan yang bermutu dan menguntungkan lingkungan. 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm.

109 SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Yang paling penting diantara tiga faktor tersebut, menurut teori kepemimpinan kontingensi adalah : Struktur tugas; c. Situasi; Hubungan pimpinan dengan bawahan; d. Kekuasaan jabatan. Teori kepemimpinan tiga dimensi dikemukakan oleh : Hendrick C. Boyd; c. William J. Reddin; Albert D. Pearce; d. Edward K. Knots. Teori kepemimpinan tiga dimensi mengemukakan adanya empat gaya dasar kepemimpinan. Tiga dari gaya dasar tersebut adalah : Integrated, related, dan corelated; Dedicated, sparated, dan deserted; Corelated, dedicated, dan integrated; Sparated, integrated, dan related. Gaya kepemimpinan yang efektif menurut teori tiga dimensi hanya dapat dipahami dalam kaitannya dengan : Tujuan yang hendak dicapai; Situasi yang dihadapi; Lingkungan kegiatan; Komposisi bawahan. 9. Gaya kepemimpinan eksekutif dapat terjadi bila pemimpin : Memberi kepercayaan dan kemudahan untuk berkembang kepada bawahan; Mendelegasikan wewenang kepada bawahan untuk mengambil keputusan; Memenuhi kebutuhan anggota dalam menetapkan dan mencapai tujuan serta memperhatikan hubungan antar anggota; Memiliki tatakerja yang berstruktur dan jelas bagi anggotanya. Teori kepemimpinan situasional dikembangkan oleh : Paul Hersey dan Kenneth H. Blanchard; Hemphill dan Coons; Paul Hersey dan Coons; Hemphill dan Kenneth H. Blanchard. Diantara faktor-faktor berikut yang merupakan faktor penting menentukan dalam teori kepemimpinan situasional adalah : Pemimpin; c. Organisasi; Pengikut; d. Tuntutan kerja dan waktu. Teori kepemimpinan situasional berasumsi bahwa hubungan yang efektif antara pemimpin dengan pengikut tergantung pada : Taraf kematangan pengikut dan kemauan pemimpin untuk menyesuaikan orientasinya;

110 Taraf kemampuan pemimpin dan kesediaan pengikut untuk memahaminya; Sifat organisasi dan kesesuaian pengikut dalam organisasi; Sifat organisasi dan kejelasan tuntutan kerja dan waktu. Untuk menentukan gaya kepemimpinan yang cocok pada suatu situasi kegiatan apakah yang pertama-tama harus dilakukan pemimpin menurut teori situasional : Menjelaskan kepada pengikut situasi yang dihadapi organisasi; Menjelaskan tugas-tugas individu atau kelompok dalam organisasi; Mengukur taraf individu atau kelompok yang dipimpin; Mengukur kesediaan pengikut menerima tugas yang diberikan. Gaya kepemimpinan efektif “telling” menurut situasinal adalah : Perilaku pemimpin yang memberikan tekanan tinggi baik pada tugas maupun hubungan; Perilaku pimpinan yang memberikan tekanan tinggi pada hubungan tetapi dengan tugas yang rendah; Perilaku pemimpin yang memberikan tekanan rendah baik pada tugas maupun hubungan; Perilaku pemimpin yang memberikan tekanan tinggi pada tugas tetapi rendah pada hubungan. 10. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

111 Pertemuan 13 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Landasan Teori Kepemimpinan Transformasional Bass (1985) mengemukakan sebuah teori kepemimpinan transformasional (transformational leadership) yang dibangun atas gagasan-gagasan yang lebih awal dari Burns (1978). Tingkatan sejauh mana seorang pemimpin disebut transformasional terutama diukur dalam hubungannya dengan efek pemimpin tersebut terhadap para pengikutnya. Para pengikut seorang pemimpin transformssional merasa adanya kepercayaan, kekaguman, kesetiaan dan hormat terhadap pemimpin tersebut serta mereka termotivasi untuk melakukan lebih daripada yang awalnya diharapkan terhadap mereka. Pemimpin tersebut mentransformasi dan memotivasi para pengikutnya dengan: (a) membuat mereka lebih sadar mengenai pentingnya hasil-hasil suatu pekerjaan, (b) mendorong mereka untuk lebih mementingkan organisasi atau tim daripada kepentingan diri sendiri dan (c) mengaktifkan kebutuhan-kebutuhan mereka pada yang lebih tinggi. Formulasi asli dari teori tersebut di atas mencakup tiga komponen kepemimpinan transformasional yaitu: (1) karisma, (2) stimulasi intelektual dan (3) perhatian yang diindividualisasi. Karisma telah didefinisikan sebagai sebuah proses yang padanya seorang pemimpin mempengaruhi para pengikutnya dengan menimbulkan emosi-emosi yang kuat dan identifikasi dengan pemimpin tersebut. Stimulasi intelektual adalah sebuah proses yang padanya para pemimpin meningkatkan keasadaran para pengikutnya terhadap masalah-masalah dan mempengaruhi para pengikutnya untuk memandang masalah-masalah tersebut dari sebuah prespektif yang baru. Perhatian yang diindividualisasi termasuk memberi dukungan, membesarkan hati, dan memberi pengalaman-pengalaman tentang pengembangan kepada para pengikut. Sebuah revisi baru dari teori tersebut menambahkan perilaku transformasional yang lain yang disebut ”inspirasi” atau ”motivasi inspirasional”. Motivasi inspirasional didefinisikan sebagai sejauh mana seorang

112 pemimpin mengkomunikasikan sebuah visi yang menarik, menggunakan simbol-simbol untuk memfokuskan usaha-usaha bawahan dan memodelkan perilaku-perilaku yang sesuai (Bass & Avolio, 1990). Kepemimpinan transformasional dibangun dari dua kata, yaitu kepemimpinan (leadership) dan transformasional (transformational). Kepemimpinan sebagaimana telah dijelaskan di awal merupakan setiap tindakan yang dilakukan oleh seseorang untuk mengkoordinasikan, mengarahkan dan mempengaruhi orang lain dalam memilih dan mencapai tujuan yang telah ditetapkan. Istilah transformasi berasal dari kata to transform, yang bermakna mentransformasikan atau mengubah sesuatu menjadi bentuk lain yang berbeda, misalnya mentransformasikan visi menjadi realita, atau mengubah sesuatu yang potensial menjadi aktual. Dengan demikian seorang kepala sekolah dapat dikatakan menerapkan kepemimpinan transformasional jika dia mampu mengubah energi sumber-sumber daya baik manusia ataupun non manusia untuk mencapai tujuan-tujuan sekolah. Sebagaimana didefinisikan oleh Sudarwan Danim (2003: 54) adalah: “kemampuan seorang pemimpin dalam bekerja dengan dan/atau melalui orang lain untuk mentransformasikan secara optimal sumber daya organisasi yang langka dalam rangka mencapai tujuan yang bermakna sesuai dengan target capaian yang telah ditetapkan”. Para ahli seperti Bass, 1985; Bass dan Avoilo, 1990 meyakini bahwa seiring dengan perubahan-perubahan yang cepat, kompleks, dan canggih dalam kehidupan manusia, kepemimpinan transformasional dapat mengimbangi pola pikir dan refleksi paradigma-paradigma baru di dalam proses perubahan. Perubahan sebagai konsep masa depan sering disebut dengan pembaharuan atau reformasi. Kata reformasi menjadi sebuah kata yang sangat popular di kalangan kita, lalu apa sebenarnya yang disebut dengan perubahan atau reformasi ? Perubahan atau reformasi adalah suatu proses transformasi yang menuju kearah terwujudnya keadaan baru, kondisi yang lebih baik dibandingkan dengan keadaan sebelumnya (Wahyo Sumidjo: 1999). Transformasi tersebut tidak hanya menyangkut salah satu aspek kehidupan secara total. Seperti dalam bidang social, politik, ekonomi pemerintahan dan budaya. Dalam aspek pemerintahan termasuk di dalamnya adalah aspek administrasi, manajemen, organisasi, proses kerja, sumber daya manusia, dsb. Seorang pemimpin dalam era pembaharuan adalah seseorang yang mampu menciptakan suatu lingkungan yang inovatif yang tidak menghambat kreativitas murni dan potensi kekuatan kerja. Pemimpin pembaharuan memberikan arah dan pandangan keluar demi kebutuhan bawahan. Pemimpin membantu untuk menciptakan suatu lingkungan kebanggaan, loyalitas, bukan ketakutan dan intimidasi. Peran seorang pemimpin pembaharuan menyangkut hal-hal strategis sebagai berikut:

113 a. Memperbaiki penampilan SDM dan sumber daya lainnya, serta untuk memperbaiki kualitas, meningkatkan hasil, dan secara simultan untuk menimbulkan kebanggaan semangat kerja para bawahan. b. Tidak hanya menemukan dan mencatat kegagalan SDM, melainkan untuk menghasilkan sebab-sebab kegagalan, membantu bawahan untuk melakukan tugas yang lebih baik. c. Menciptakan suatu lingkungan kerja yang produktif, menampilkan kepemimpinan yang inovatif, dan melatih para bawahan demi melaksanakan tugas. Definisi Kepemimpinan transformasional Adapun komitmen perilaku kepemimpinan transformasional menurut Leithwood dkk (1999) mengatakan “transformational leadership is seen to be sensitive to organiation building developing shared vision, distributing leadership and building school culture necessary to current restructuring efforts in school”. Adapun Burns (1978), orang yang disebut-sebut sebagai yang Pertama kali menggagasnya, mendefinisikan kepemimpinan transformasional sebagai “a process in which leaders and followers raise to higher levels of morality and motivation”. Gaya kepemimpinan semacam ini akan mampu membawa kesadaran para pengikut (followers) dengan memunculkan ide-ide produktif, hubungan yang sinergikal, kebertanggungjawaban, kepedulian edukasional, dan cita-cita bersama. Pemimpin dengan kepemimpinan transformasional adalah kepemimpinan yang memiliki visi ke depan dan mampu mengidentifikasi perubahan lingkungan serta mampu mentransformasi perubahan tersebut ke dalam organisasi; mempelopori perubahan dan memberikan motivasi dan inpsirasi kepada individu-individu karyawan untuk kreatif dan inovatif, serta membangun team work yang solid; membawa pembaharuan dalam etos kerja dan kinerja manajemen; berani dan bertanggung jawab memimpin dan mengendalikan organisasi (Bass, 1985). Yukl (1994) menyimpulkan esensi kepemimpinan transformasional adalah memberdayakan para pengikutnya untuk berkinerja secara efektif dengan membangun komitmen mereka terhadap nilai-nilai baru, mengembangkan ketrampilan dan kepercayaan mereka, menciptakan iklim yang kondusif bagi berkembangnya inovasi dan kreativitas. House et.al (1996) dalam Suyanto (2003) menyatakan bahwa pemimpin yang transformasional memotivasi bawahan mereka untuk “berkinerja di atas dan melebihi panggilan tugasnya.” Esensi kepemimpinan transformasional adalah sharing of power dengan melibatkan bawahan secara bersama-sama untuk melakukan perubahan (http:www.pdk.go.id/jurnal/kepemimpinan,2005). Dalam merumuskan perubahan biasanya digunakan pendekatan transformasional yang manusiawi, dimana lingkungan kerja yang partisipatif dengan model manajemen yang kolegial yang penuh keterbukaan dan keputusan diambil bersama. Dengan demikian kepemimpinan transformasional adalah kepemimpinan yang mampu menciptakan perubahan yang mendasar dan dilandasi oleh nilai-nilai agama, sistem dan budaya untuk menciptakan inovasi dan kreativitas pengikutnya dalam rangka mencapai visi yang telah ditetapkan.

114 Pemimpin transformasional sesungguhnya merupakan agen perubahan, karena memang erat kaitannya dengan transformasi yang terjadi dalam suatu organisasi. Fungsi utamanya adalah berperan sebagai katalis perubahan, bukannya sebagai pengontrol perubahan. Seorang pemimpin trasnformasional memiliki visi yang jelas, memiliki gambaran holistik tentang bagaimana organisasi di masa depan ketika semua tujuan dan sasarannya telah tercapai (Covey, 1989; Peters, 1992). Sergiovanni (1990: 21) berargumentasi bahwa makna simbolis dari tindakan seorang pemimpin transformasional adalah lebih penting dari tindakan aktual. Nilai-nilai yang dijunjung oleh pemimpin yang terpenting adalah segalanya. Artinya ia menjadi model dari nilai-nilai tersebut, menstrasnformasikan nilai organisasi jika perlu untuk membantu mewujudkan visi organisasi. Elemen yang paling utama dari karakteristik seorang pemimpin transformasional adalah dia harus memiliki hasrat yang kuat untuk mencapai tujuan organisasi. Seorang pemimpin transformasional adalah seorang pemimpin yang mempunyai keahlian diagnosis, dan selalu meluangkan waktu dan mencurahkan perhatian dalam upaya untuk memecahkan masalah dari berbagai aspek. Bass (1994) memberikan model transformasional seperti ditunjukan pada gambar berikut: Kondisi sekarang dari upaya yang diharapkan bawahan Makin meningginya motivasi bawahan untuk mencapai hasil dengan upaya tambahan Bawahan menghasilkan kinerja sebagaimana yang diharapkan Bawahan mempersembahkan kinerja melebihi apa yang diharapkan Pemimpin mempetinggi nilai kebenaran bawahan Pemimpin memperluas kebutuhan bawahan Pemimpin mentrasn- formasikan perhatian kebutuhan bawahan Pemimpin mengangkat nuansa kebutuhan bawahan ke tingkatan yang lebih tinggi pada hirarki motivasi Pemimpin mempertinggi probabilitas keberhasilan yang subjektif Pemimpin membangun rasa percaya diri bawahan Transformasional organisasi

115 Gambar 6.9 Model Kepemimpinan Transformasional Sumber : Bass dan Avolio (1994) Dimensi-dimensi Kepemimpinan Transformasional Bass dan Avolio (1994) mengusulkan empat dimensi dalam kadar kepemimpinan seseorang dengan konsep “4I” yang artinya: a) “I” pertama adalah idealized influence, yang dijelaskan sebagai perilaku yang menghasilkan rasa hormat (respect) dan rasa percaya diri (trust) dari orang-orang yang dipimpinnya. Idealized influence mengandung makna saling berbagi resiko, melalui pertimbangan atas kebutuhan yang dipimpin di atas kebutuhan pribadi, dan perilaku moral serta etis. b) “I” kedua adalah inspirational motivation, yang tercermin dalam perilaku yang senantiasa menyediakan tantangan dan makna atas pekerjaan orang-orang yang dipimpin, termasuk di dalamnya adalah perilaku yang mampu mengartikulasikan ekspektasi yang jelas dan perilaku yang mampu mendemonstrasikan komitmen terhadap sasaran organisasi. Semangat ini dibangkitkan melalui antusisme dan optimisme. c) “I” ketiga adalah intellectual simulation. Pemimpin yang mendemonstrasikan tipe kepemimpinan seantiasa menggali ide-ide baru dan solusi yang kreatif dari orang-orang yang dipimpinnya. Ia juga selalu mendorong pendekatan baru dalam melakukan pekerjaan. d) “I” keempat adalah individualized consideration, yang direfleksikan oleh pemimpin yang selalu mendengarkan dengan penuh perhatian, dan memberikan perhatian khusus kepada kebutuhan prestasi dan kebutuhan dari orang-orang yang dipimpinnya. Perbandingan Kepemimpinan Transforming, Transformasional dan Transaksional Kepemimpinan transforming atau kepemimpinan yang mentransformasi adalah pendekatan teori kepemimpinan mutakhir yang dalam dua dekade ini sedang hangat-hangatnya dibicarakan. Perilaku kepemimpinan transforming ialah kepemimpinan yang memiliki kesadaran sendiri tentang emosionalnya, manajemen diri sendiri, kesadaran sosial dan manajemen hubungan kerja (Golmen, et.al, 2003). Pola perilaku kepemimpinan yang seperti ini diharapkan berpengaruh positif terhadap bawahannya dalam membentuk nilai-nilai dan keyakinan untuk mencapai tujuan organisasi (Anderson, 1998). Bass (1985) mengemukakan bahwa pemimpin transformasional adalah seseorang yang mampu meningkatkan motivasi dan komitmen bawahan terhadap kelompok tanpa menghiraukan akibat negatifnya. Pencapaian perwujudan transformasional memerlukan kerangka pikir kerja sumber daya manusia dan manusia bersumber daya. Tabel berikut menunjukkan perbandingan antara konsep sumber daya manusia dengan manusia bersumber daya.

116 Tabel 6.1 Perbandingan Paradigma Sumber : Bass dan Aviolo (1994) P a r a d i g m a S u m b e r D a y a Ma n u s i a P a r a d i g m a M a n u s i a B e r s u m b e r D a y a Doktrin Hubungan Organisasi *Termination-at Will* Keanggotaan Organisasi Fokus Manajemen Orang Kepentingan Organisasi dan Penguasa Kesejahteraan anggota organisasi dan keunggulan organisasi Pendekatan Psikologi Dominan Psikologi organisasi Psikologi vocational Satuan Analisis Pekerjaan Pekerja Potensi orang yang dicari Kompetensi Kompetensi, wawasan, motivasi kerja dan sem angat belajar inovatif Makna Pekerjaan Okupasi yang disediakan organisasi bagi pekerja Vokasi yang menjadi pilihan pekerja Sifat hubungan kerja Kontraktual Atas dasar rasa saling percaya Pengembangan Orang Membangun kompetensi spesifik Membangun kompetensi generic, wawasan usaha, dan budaya belajar inovatif Kepemimpinan yang efektif di Tempat Kerja Supervisi dan transaksional Visioner dan transformasional Sikap Terhadap Perubahan Tanggungjawab manajemen Tanggungjawab bersama Fokus Perhatian Manajemen Efisiensi,produktivitas dan efektivitas Keunggulan sistem usaha dan kesejah-teraan pekerja Proses Manajemen Baku,spesifik, tuntas dan efektifitas Berkembang, umum, incremental, dan berkesinambungan Orientasi Kerja Berjangka pendek, ruang lingkup spesifik, dan statis Berjangka panjang, berwawasan luas,dan dinamis Keberhasilan transformasional sangat ditentukan oleh manusia bersumber daya melalui berbagai upaya secara holistik. Perbedaan pandangan Burns dan Bass terdapat beberapa aspek, antara lain : 1) Burns membatasi proses transformasi sebagai sesuatu yang menanamkan nilai-nilai moral yang positif dan dapat meningkatkan ordo kebutuhan bawahan. Sedangkan Bass, mengemukakan bahwa pemimpin transformasional adalah seseorang yang mampu meningkatkan motivasi dan komitmen bawahan terhadap kelompok tanpa menghiraukan akibat negatifnya. 2) Burns memandang kepemimpinan transformasional sebagai sesuatu yang bertolak belakang dan berdiri sendiri terlepas dari kepemimpinan transaksional. Sedangkan Bass, berpendapat bahwa secara konseptual dan empiris banyak pemimpin yang memperlihatkan kepemimpinan

117 transformasional dan transaksional sekaligus, tetapi masing-masing dalam kadar tertentu. Kepemimpinan transformasional dapat dipandang secara makro dan mikro, kepemimpinan transformasional sebagai proses mempengaruhi antar individu, sementara secara makro merupakan proses memobilisasi kekuatan untuk merubah sistem sosial dan mereformasi kelembagaan. Konsep transformasional dan transaksional muncul disebabkan adanya gejala bahwa praktek-praktek kepemimpinan terdahulu hanya mampu menciptakan perubahan yang kurang mendasar seperti; menetapkan sasaran yang baru, merubah suatu tindakan yang kurang di sukai. Bass dan Avolio (1990) menjelaskan bahwa model kepemimpinan transformasional dan kepemimpinan transaksional mirip dengan konsep model pemimpin dan manajer. Dalam pengertian ini, seorang pemimpin transformasional selalu muncul dalam situasi krisis, masa perubahan, dan selalu berkembang, sementara pemimpin transaksional bekerja dalam situasi yang lebih bersifat birokratis mekanistis, yang cenderung menyukai kondisi status quo. Bennis dan Drucker yang menjelaskan bahwa perbedaan manajer dan pemimpin dalam suatu ungkapan popular “manajemen adalah bagaimana mengerjakan sesuatu dengan benar”, sedangkan kepemimpinan adalah “bagaimana menentukan sesuatu yang benar untuk dikerjakan” (management is doing things right, leadership is doing the right thing). Sebagai gambaran perbedaan konsep manajer dan pemimpin dapat ditunjukkan pada tabel berikut ini : Tabel 6.2 Perbandingan antara Manajer dan Pemimpin MANAJER PEMIMPIN Perbedaan Perilaku Manajerial Bekerja di dalam batas-batas ruang lingkup tanggung jawabnya dan memenuhi peraturan dan ketentuan yang berlaku Lebih tertarik untuk memenuhi kebutuhan perusahaan yang lebih besar dan merealisasikan tanggung jawab social Lebih tertarik untuk mengerjakan tugas dengan baik sesuai dengan cara yang sudah ditetapkan Merumuskan perhatian pada pelaksanaan tugas yang benar, memilih apa yang baru dikerjakan dan mengapa hal itu perlu dikerjakan Perbedaan Fungsional Perencanaan bersifat ritun dan terbatas pada biadng tugasnya Perencanaan yang berwawasan luas dan menjangkau jauh ke depan Mengatur penempatan staff untuk mengisi lowongan di dalam struktur organisasi Menemukan dan mengembangkan professional dalam rangka membangun institusi Menugaskan apa yang harus dikerjakan bawahan Menjelaskan apa yang perlu dicapai Mengendalikan pekerja agar mereka mengerjakan apa yang ditugaskan sesuai dengan peraturan yang berlaku Memberi kebebasan pada pengikut untuk mencari cara yang terbaik guna mencapai tujuan secara bertanggung jawab Perbedaan Minat Perhatian lebih banyak ke dalam (internal) Berminat pada penggalangan dukungan dari para konsultan dan mendapatkan sumberdaya Lebih tertarik pada hal-hal teknis daripada kegiatan bisnis Lebih tertarik pada aspek-aspek sosio politis dan psikologis dan kegiatan bisnis Menjual produk dan jasa konkret Menjual gagasan, pemikiran, perasaan, dan emosi yang dikaitkan dengan tindakan konkret Menghindarkan konflik Konflik adalah hal yang wajar Pemecahan persoalan jangka pendek dengan tindakan yang berencana Membangun consensus tentang visi masa depan dan tindakan konkret untuk mewujudkannya Perbedaan Dalam Membangun Pengaruh Memiliki bawahan Memiliki pengaruh Besar kekuasaan ditentukan oleh posisinya di dalam organisasi Kekuasaan terbentuk dari visi pimpinan dan kemampuannya untuk mengkomunikasikan visi itu kepada pengikutnya Mencari stabilitas, kepastian dan kemampuan untuk mengontrol Mencari fleksibilitas dan perubahan Perubahan perlu dihindari, dikelola atau dikendalikan Perubahan dianggap biasa dan perlu dimanfaatkan Kegagalan perlu dihindari dan dicegah sekuat tenaga Kegagalan adalah konsekuensi logis dari usaha menjadi wilayah yang tidak diketahui dan dapat menjadi pelajaran yang berharga Perbedaan Dalam Pola Pikir Analitis dan konvergen Intuitif dan divergen Mengambil keputusan dan memecah-kan persoalan bagi pekerjanya Memberi pengarahan dan kebebasan kepada para pengikut untuk mengambil keputusan dan memecahkan persoalan mereka sendiri secara betanggung jawab Menekankan hal-hal yang rasional dan konkret Menekankan hal-hal yang kurang konkret, seperti visi, wawasan, tata nilai dan motivasi Berpikir dan bertindak untuk jangka pendek Berpikir dan bertindak dalam jangka panjang Menerima dan mematuhi secara ketat struktur organisasi, kebijakan, prosedur dan metodologi yang ada Selalu mencari cara-cara yang lebih baik Sumber : Bas dan Aviolo (1994)

118 Burns membedakan kepemimpinan yang mentransformasi (transforming leadership) dengan kepemimpinan transaksional (transactional leadership). Jenis kepemimpinan yang terakhir memotivasi para pengikut dengan menunjuk pada kepentingan diri sendiri. Para pemimpin politik tukar menukar pekerjaan, subsidi dan kontrak-kontrak pemerintah yang menguntungkan untuk memperoleh suara dan kontribusi untuk kampanye. Para pemimpin korporasi saling menukar upah dan usaha transaksional dengan bawahan menyangkut nilai-nilai, berupa nilai-nilai yang relevan bagi proses pertukaran, seperti kejujuran, keadilan, tanggungjawab. Kepemimpinan adalah sebuah proses, bukan sejumlah tindakan yang mempunyai ciri-ciri sendiri. Implementasi Kepemimpinan Transformasional dalam Pendidikan Implementasi model kepemimpinan transformasional dalam bidang pendidikan memang perlu diterapkan seperti kepala sekolah, kepala dinas, dirjen, kepala departemen dan lain-lain. Model kepemimpinan ini memang perlu diterapkan sebagai salah satu solusi krisis kepemimpinan terutama dalam bidang pendidikan. Adapun alasan-alasan mengapa perlu diterapkan model kepemimpinan transformasional didasarkan pendapat Olga Epitropika (2001 :1) mengemukakan enam hal mengapa kepemimpinan transformasional penting bagi suatu organisasi, yaitu : a. Secara signifikan meningkatkan kinerja organisasi b. Secara positif dihubungkan dengan orientasi pemasaran jangka panjang dan kepuasan pelanggan c. Membangkitkan komitmen yang lebih tinggi para anggotanya terhadap organisasi d. Meningkatkan kepercayan pekerja dalam manajemen dan perilaku keseharian organisasi e. Meningkatkan kepuasan pekerja melalui pekerjaan dan pemimpin, f. Mengurangi stress para pekerja dan meningkatkan kesejahteraan Implementasi model kepemimpinan transformasional dalam organisasi/instansi pendidikan perlu memperhatikan beberapa hal sebagai berikut: - Mengacu pada nilai-nilai agama yang ada dalam organisasi/instansi atau bahkan suatu negara. - Disesuaikan dengan nilai-nilai yang terkandung dalam sistem organisasi/instansi tersebut. - Menggali budaya yang ada dalam organisasi tersebut. - Karena sistem pendidikan merupakan suatu sub sistem maka harus memperhatikan sistem yang lebih besar yang ada di atasnya seperti sistem negara. 5. Informasi pendukung

119 SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Produktivitas suatu pekerjaan sebagian besar tergantung pada kemauan pekerja untuk menghasilkan sesuatu. Pernyataan ini merupakan anggapan yang dianut oleh: Teori situasional; c. Teori kontingensi; Teori motivasi; d. Teori Keperilakuan. Teori X dan Teori Y dikembangkan oleh : Frederick Herzberg; c. Dauglas Mc. Gregor; Bernard Mauser; d. Barbara Snyderman. Salah satu asumsi dari teori X adalah : Manusia itu malas bekerja; Manusia tidak memiliki rasa tanggungjawab; Mengendalikan diri itu penting; 9. Salah satu asumsi teori Y adalah : Manusia hanya akan bekerja bila diperintah; Manusia tidak memiliki rasa tanggungjawab; Bekerja pada umumnya sama dengan bermain; Manusia tidak memiliki kemampuan berkreasi. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : Memberi kepercayaan kepada bawahan; Membuat tugas dengan jelas dan berstruktur; Mendorong bawahan untuk berinisiatif; Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : Kekuasaan, rasa aman, dan keberhasilan; Rasa aman, keberhasilan, dan kekuasaan; Penghargaan, rasa aman, dan afisiasi; Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan.

120 Ciri-ciri pemimpin yang efektif antara lain : Bersedia melepaskan sebagian wewenangnya kepada bawahan, dan menumbuhkan motivasi bawahan, serta mampu mendorong bawahan mencari jalan pemecahan masalah yang dihadapi; Senang bergaul dengan bawahan, bersedia melepaskan sebagian wewenangnya kepada bawahan, dan dapat menumbuhkan motivasi bawahan; Dapat mengidentifikasi staf yang berbakat, bersedia melepaskan wewenangnya kepada bawahan, dan mampu mendorong bawahan mencari jalan pemecahan permasalahan yang dihadapi; Mau belajar sepanjang hidupnya, mau bergaul dengan bawahan, dan mapu memobilitas bawahan. Tugas kepala sekolah yang paling penting antara lain ; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat dan menyempurnakan kurikulum; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat, dan mengusahakan timbulnya penghargaan dari murid; Memelihara hubungan dengan petugas-petugas dari instansi, mengusahakan support dari masyarakat, dan bekerja sama dengan bawahan; Berpartisipasi dengan masyarakat dalam berbagai kegiatan, bekerjasama dengan atasan, dan memimpin meningkatkan sekolah. Mengembangkan kesanggupan dan kelebihan pada pada yang dipimpinnya sehingga yang dipimpinnya ini dapat pula menjadi pemimpin. Merupakan tugas dari : Pemimpin; c. Pendidik sebagai pemimpin; Pendidik; d. Pemimpinsebagai pendidik. 10. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

121 Pertemuan 14 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran Guru, wali kelas, kepala sekolah, pengawas, kepala kantor bidang pendidikan pada semua tingkatan, semua tenaga edukatif pada kantor dinas kepala direktorat dalam lingkungan direktorat jenderal pendidikan, ketua jurusan, dekan, rektor dan pembantu-pembantunya pada sekolah tinggi, akademi, institut dan universitas, ahli-ahli ilmu pendidikan dan masih banyak lagi, merupakan pemimpin-pemimpin pendidikan. Pada pokoknya setiap orang yang memiliki kelebihan dalam kemampuan dan pribadinya, dan dengan kelebihannya itu dapat mempengaruhi, mengajak, membimbing, mendorong, menggerakkan dan mengkoordinasikan staf pendidikan lainnya ke arah peningkatan atau perbaikan mutu pendidikan dan pengajaran, maka ia telah melaksanakan fungsi kepemimpinan pendidikan, dan ia tergolong sebagai pemimpin pendidikan. Dengan demikian maka pemimpin pendidikan itu dapat berstatus pemimpin resmi yang biasa disebut “status leader” atau “formal leader”, atau “functional leader”. Kepemimpinan resmi dimiliki oleh mereka yang menduduki posisi dalam struktur organisasi pendidikan, baik secara resmi oleh pihak atasan atau yang berwenang maupun karena dipilih secara resmi menjadi pemimpin oleh anggota staf pelaksana pendidikan di mana ia bekerja. Misalnya Kepala Sekolah, Kepala Dinas Pendidikan adalah termasuk kategori pemimpin resmi dan memiliki kepemimpinan resmi dilihat dari segi posisi dan sistem pengangkatan. Kepemimpinan tidak resmi bisa dimiliki oleh mereka yang mempengaruhi, memberi tauladan, dan mendorong ke arah perbaikan kualitas kerja petugas-petugas penyelenggara pendidikan dan pengajaran, meskipun di dalam hierarki sturktur organisasi pendidikan mungkin ia tidak menduduki posisi pemimpin. Kemampuannya itu semata-mata berasal dari kelebihan tertentu yang ada pada pribadinya, dan bukan karena ia menduduki posisi pemimpin, baik karena

122 pengangkatan dari pihak yang berwenang maupun karena dipilih secara resmi oleh kalangan kelompok kerja. Seorang kepala sekolah atau seorang kepala dinas pendidikan sebagai “status leader” atau “formal leader”, lebih disegani, lebih ditaati petunjuk-petunjuk atau perintah-perintahnya oleh murid-muridnya atau anggota staffnya, mungkin semata-mata karena kedudukannya yang resmi sebagai pemimpin, karena kekuasaan resmi yang ia miliki sebagai pemimpin resmi. Kepala Sekolah sebagai Pemimpin Pendidikan Fungsi utama kepala sekolah sebagai pemimpin pendidikan ialah menciptakan situasi belajar mengajar sehingga guru-guru dapat mengajar dan murid-murid dapat belajar dengan baik. Dalam melaksanakan fungsi tersebut, kepala skeolah memiliki tanggungjawab ganda yaitu melaksanakan administrasi sekolah sehingga tercipta situasi belajar mengajar yang baik, dan melaksanakan supervisi sehingga kemampuan guru-guru meningkat dalam membimbing pertumbuhan murid-muridnya. Sebagai pemimpin pendidikan, kepala sekolah menghadapi tantangan yang berat, untuk itu ia harus memiliki persiapanyang memadai. Karena banyaknya tanggungjawab maka kepala sekolah memerlukan pembantu. Ia hendaknya belajar bagaimana mendelegasikan wewenang dan tanggungjawab sehingga ia dapat memusatkan perhatiannya pada usaha pembinaan program pengajaran. Pekerjaan pemimpin pendidikan ialah menstimulir dan membimbing pertumbuhan guru-guru berkesinambungan sehingga mereka mampu menjalankan tugasnya dengan sebaik-baiknya sesuai dengan perkembangan situasi. Kepala sekolah sebagai pemimpin pendidikan, harus mampu mengelola sarana dan prasarana pendidikan, pelayanan khusus sekolah dan fasilitas-fasilitas pendidikan lainnya sedemikian rupa sehingga guru-guru dan murid-murid memperolah kepuasan dalam melaksanakan tugasnya. Sebagai pemimpin pendidikan, Kepala Sekolah bertanggungjawab atas pertumbuhan guru-guru secara berkesinambungan, ia harus mampu membantu guru-guru mengenal kebutuhan masyarakat, membantu guru membina kurikulum sesuai dengan minat, kebutuhan dan kemampuan peserta didik. Ia harus mampu menstikulir guru-guru untuk mengembangkan metode dan prosedur pengajaran. Ia harus mampu membantu guru-guru mengevaluasi program pendidikan dan hasil belajar murid, ia harus mampu juga menilai sifat dan kemampuan guru, sehingga Kepala Sekolah dapat membantu meningkatkan kemampuan guru. Untuk dapat melaksanakan tanggungjawab tersebut di atas, kepala sekolah harus memiliki pendidikan dan pengalaman yang diperlukan bagi seorang pemimpin pendidikan. 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm.

123 SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi Tugas kepala sekolah yang paling penting antara lain ; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat dan menyempurnakan kurikulum; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat, dan mengusahakan timbulnya penghargaan dari murid; Memelihara hubungan dengan petugas-petugas dari instansi, mengusahakan support dari masyarakat, dan bekerja sama dengan bawahan; Berpartisipasi dengan masyarakat dalam berbagai kegiatan, bekerjasama dengan atasan, dan memimpin meningkatkan sekolah. Mengembangkan kesanggupan dan kelebihan pada pada yang dipimpinnya sehingga yang dipimpinnya ini dapat pula menjadi pemimpin. Merupakan tugas dari : Pemimpin; c. Pendidik sebagai pemimpin; Pendidik; d. Pemimpinsebagai pendidik. Pendekatan perilaku (behavioral approach) memandang bahwa kepemimpinan dapat dipelajari dari : Emosi pemimpin yang stabil; Tindakan pemimpin dalam mengambil keputusan; Pendidik yang berwawasan luas; Pemimpin yang mempunyai energi yang kuat. Keterampilan hubungan kemanusiaan (human relation skill) memiliki kekuatan-kekuatan untuk setiap tingkatan/posisi manager, yaitu : Tinggi derajat penguasaannya untuk top manager; Tinggi derajat penguasaannya untuk midlle manager; Rendah derajat penguasaannya untuk lower manager; Sama derajat (tinggi) penguasaannya baik untuk top, midlle, maupun lower manager. Legalitas seorang pemimpin dalam menjalankan kepemimpinanya adalah : Responsibility Power Human Relation Task Oriented Basis kekuasaan yang menggunakan perilaku, tata nilai yang dibentuk dan norma-norma pisitf yang melekat pada diri sendiri sebagai kebiasaan dan pandangan orang lain termasuk ke dalam basis kekuasaan : Coercive Reference Information Reward

124 Kemampuan pemimpin untuk dapat memfasilitasi perubahan dengan kepemilikan visi dan misi organisasi yang harus dimiliki oleh setiap orang adalah pimpinan dengan gaya : Succesfull Colaborative Transformational Democrative Kepala Sekolah adalah “Key Person” di sekolah, kata yang tercetak tebal memiliki pengertian seperti di bawah ini kecuali : Pengambil keputusan Pemimpin sekolah Penerus kekuasaan Pengemban visi sekolah Kekuasaan seorang pemimpin dibatasi oleh variable-variabel kemanusiaan dan variable-variabel yang melekat pada jabatannya, pada intinya kekuasaan seorang pemimpin titik akhirnya adalah dalam bentuk : Kemandirian bawahan Kecemasan bahawan Kepatuhan bawahan Kepuasan bawahan Pemimpin tidak selamanya baik, benar, jurjur dalam perilakunya seperti tuntutan bawahannya, akan tetapi muncul dalam bentuk isitlah pemimpin yang abnormal. Apa yang dimaksud dengan pemimpin abnormal tersebut ? Pemimpin yang memiliki pandangan masa depan yang luas Pemimpin yang memiliki kelebihan dibandingkan dengan yang lainnya dan di luar batas-batas penerimaan bawahannya Pemimpin yang memiliki kelebihan energi pribadinya Pemimpin yang menggunakan kekuasannya di luar batas-batas kekuasaannya. 9. Respon atau balikan terhadap hasil evaluasi Setiap item jawaban yang benar diberkan nilai 20, bila Anda belum mencapai 80% untuk nilai yang diperoleh silahkan baca ulang dengan teliti dan baik, kemudian kerjakan kembali soal diatas. Keterangan Tingkat penguasaan = x 100% 100 Arti tinggkat penguasaan Anda: 90% - 100% = baik sekali 80% - 89% = baik 70% - 79% = cukup < 70% = kurang

125 Pertemuan 15 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi 9. Respon atau balikan terhadap hasil evaluasi

126 Pertemuan 16 1. Pokok Bahasan; 2. Kompetensi yang akan dicapai; 3. Petunjuk belajar - Mulailah dengan basmallah - Datang tepat pada waktunya di dalam kelas - Mendengarkan setiap pembicaraan dosen - Bertanya apabila ada yang belum dipahami - Meminta silabus perkuliahan kepada dosen - Membaca setiap isi silabus dengan seksama 4. Konten atau isi materi pembelajaran 5. Informasi pendukung SEDL,. (1993), Vision, Leadership, and Change, SEDL – Issues About Change Vision, Leadership , and Change. htm. SEDL., (1994), Leadership: An Imperative for Successful Change, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. SEDL., (1994), Total Quality: A Missing Piece for Educational Improvement ?, SEDL – Issues About Leadership An Imperatif for Successful Change.htm. 6. Latihan-latihan 7. Lembar Kerja (LK) 8. Evaluasi UJIAN AKHIR SEMESTER GANJIL JURUSAN ADMINISTRASI PENDIDIKAN FIP – UPI 2005 Mata Kuliah : Kepemimpinan Pendidikan Tanggal : Januari 2006 Waktu : 90 Menit Dosen/Asisten : Dra. Taty Rosmiati, M.Pd Asep Suryana, M.Pd Nurdin, M.Pd.

127 PETUNJUK : 1. Tulis identitas kemahasiswaan saudara pada lembar jawaban 2. Semua jawaban dikerjakan pada lembar jawaban 3. Lembaran soal dalam keadaan utuh dan bersih bersama dengan jawaban dikembalikan kepada pengawas ujian 4. Untuk bagian I bubuhkan tanda silang (x) pada huruf a, b, c, atau d jika pernyataan itu saudara anggap benar untuk, bagian II tuliskan kesimpulannya dengan rapih dan terbaca. BAGIAN I : Salah satu kritik terhadap pendekatan sifat kepribadian pemimpin adalah : Setiap manusia memiliki kepribadian yang berbeda; Sifat-sifat yang dituntut bagi seorang pemimpin bertentangan satu dengan lainnya; Tidak ada manusia yang memiliki kepribadian lengkap bagi seorang pemimpin; Kepribadian manusia selalu berubah-ubah. Menurut pendekatan sifat kepribadian pemimpin, pendidikan tidak mampu membentuk seorang pemimpin sebab : Manusia dilahirkan dengan kepribadian yang unik; Kepribadian bersifat tidak dapat dirubah; Pendidikan hanya memberikan teori kepemimpinan; Kepemimpinan menuntut sifat kepribadian tertentu. Menurut Siagian pemimpin yang berhasil adalah seseorang yang : Dilahirkan dengan bakat-bakat kepemimpinan; Memperoleh kesempatan mengembangkan bakat kepemimpinannya melalui pendidikan; Memiliki pengalaman kerja; Dilahirkan dengan bakat-bakat kepemimpinannya melalui pendidikan serta memiliki pengalaman kerja. Dikatakan bahwa satu-satunya hal yang konstan di dunia ini adalah perubahan. Kondisi ini menuntut seorang pemimpin untuk memiliki sifat kepribadian : Pendidikan umum yang luas; Kemampuan berkembang secara mental; Ingin tahu; Kemampuan analisis. Adanya fungsi-fungsi yang berbeda, spesialisasi yang semakin beraneka ragam dan kepentingan yang beraneka ragam menunjukan pentingnnya sifat kepribadian : Daya ingat yang kuat; c. Keterampilan berkomunikasi; Kapasitas integrafik; d. Keterampilan mendidik. Sifat kepribadian rasionalitas dan objektivitas diartikan bahwa seorang pemimpin : Tidak boleh dikuasai oleh emosi; Mampu membuat keputusan yang dapat dilaksanakan oleh para pelaksana; Dapat menentukan urutan permasalahan berdasarkan kepentingannya (Ambeg Parama Arta); Mampu memilih saat yang tepat untuk bertindak. Sifat yang menunjang untuk terciaptanya hubungan yang akrab antara pemimpin dengan yang dipimpin adalah sifat kepribadian : Sense of Cohesiveness; Sense of Relevance; Kesederhanaan; Adaptabilitas dan fleksibilitas. Pendekatan keperilakuan berorientasi pada dua hal yaitu :

128 Tugas keorganisasian dan hubungan dengan anggota kelompoknya; Fungsi kepemimpinan dan gaya kepemimpinan; Tugas keorganisasian dan gaya kepemimpinan; Fungsi kepemimpinan dan hubungan dengan anggota kelompoknya. Yang dimaksud dengan gaya kepemimpinan adalah : Cara pemimpin berperilaku yang dikaitkan dengan situasi yang dihadapi; Cara pemimpin berperilaku yang dikaitkan dengan tujuan kegiatan; Cara pemimpin berperilaku yang dikaitkan dengan para anggota kelompoknya; Cara pemimpin berperilaku yang dikaitkan dengan lingkungan kerjanya. Perilaku struktur atau initiating structure menunjuk pada perlunya : Saling mempercayai, kehangatan, dan saluran-saluran komunikasi; Hubungan bersahabat, saluran-saluran komunikasi, dan cara mengerjakan pekerjaan; Cara mengerjakan pekerjaan, respek dalam berinteraksi, dan kehangatan Saluran-saluran komunikasi, cara mengerjakan pekerjaan, pola-pola organisasi. Berdasarkan hasil studi Ohio State University, kombinasi perilaku kepemimpinan yang paling efektif akan tercapai apabila terjadi kombinasi antara : Struktur inisiasi yang rendah dengan konsiderasi yang tinggi; Struktur inisiasi yang tinggi dengan konsiderasi yang tinggi; Struktur inisiasi yang rendah dengan konsiderasi yang rendah; Struktur inisiasi yang tinggi dengan konsiderasi yang rendah. Berdasarkan teori Managerial Grid, gaya kepemimpinan yang sangat menekankan pada hubungan antar individu tetapi tidak memperdulikan sama sekali produktivitas di sebut gaya kepemimpinan : Team; c. Country Club; Impoverished; d. Task. Teori kepemimpinan yang menggambarkan tipe kepemimpinan otoriter adalah gaya kepemimpinan : Team; c. Country Club; Impoverished; d. Task. Teori kepemimpinan berdasarkan dinamika kelompok mengemukakan bahwa tujuan kelompok dapat digolongkan menjadi dua katagori yaitu : Pencapaian tujuan dan integritas kelompok; Pencapaian tujuan dan pemanfaatan kelompok; Penetapan tujuan dan integritas kelompok; Penetapan tujuan dan integritas kelompok. Jika seorang pemimpin telah memberi kepercayaan kepada bawahan (meskipun tidak sepenuhnya), membuka kesempatan bagi bawahan untuk berpartisipasi, melibatkan bawahan untuk turut serta mengambil keputusan yang begitu penting, dan membuka kesempatan kepada bawahan (meskipun masih ada pembatasan), menurut Rensis Likert, pemimpin tersebut melaksanakan sistem kepemimpinan : Exploitive Authoritative; c. Consultative; Benevolent Authoritative; d. Partisipative. Menurut teori Likert, sistem kepemimpinan yang paling ideal adalah : Exploitive Authoritative; c. Consultative; Benevolent Authoritative; d. Partisipative. Teori dari Tannembaun dan Schmidt bertolak dari konsep demokratis dan otoriter. Dalam kaitan ini Tannembaun dan Schmidt mengemukakan bahwa seorang pemimpin : Hanya dapat mengambil salah satu konsep demokratis atau otoriter; Dapat mengambil kedua konsep tersebut dengan derajat sama tinggi; Dapat mengambil kedua konsep tersebut secara komplementer;

129 Dapat mengambil kedua konsep tersebut tergantung pada situasi. Untuk memilih gaya kepemimpinan yang paling efektif Tannembaun dan Schmidt menyerahkan tiga untuk dipertimbangkan yaitu : Kekuatan diri pemimpin, kekuatan bawahan, dan situasi; Kekuatan diri pemimpin, kekuatan bawahan, dan tujuan; Kekuatan pemimpin, situasi, dan tujuan; Kekuatan bawahan, situasi, dan tujuan. Gaya kepemimpinan kolaboratif menurut Rita Dunn dan Kenenth Dunn adalah gaya kepemimpinan yang baru : Menunjuk adanya keakraban antara pemimpin dengan anggota kelompok; Adanya pembagian kepemimpinan kepada staf; Memberi kesempatan kepada staf untuk memberikan saran atau ide; Mempunyai sedikit ruang gerak bagi staf untuk berperan serta. Getzel dan Guba mengemukakan dua gaya kepemimpinan, yaitu : Normatif dan partisipatif; c. Partisipatif dan personal; Normatif dan personal ; d. Partisipatif dan birokratis. Seorang pemimpin yang berorientasi pada pencapaian tujuan organisasi, menurut Getzels dan Guba, menekankan pada dimensi : Nomotetis; c. Ideografis; Demokratis; d. Autokratis. Menurut model kepemimpinan kontingensi, tiga faktor yang menentukan suatu situasi “favorable” bagi pemimpin, yaitu : Hubungan pemimpin dan bawahan, situasi, dan struktur tugas; Hubungan pemimpin dan bawahan, situasi, dan kekuasaan jabatan; Hubungan pemimpin dan bawahan, situasi, struktur tugas kekuasaan jabatan; Situasi, struktur tugas, dan kekuasaan jabatan. Yang paling penting diantara tiga faktor tersebut, menurut teori kepemimpinan kontingensi adalah : Struktur tugas; c. Situasi; Hubungan pimpinan dengan bawahan; d. Kekuasaan jabatan. Teori kepemimpinan tiga dimensi dikemukakan oleh : Hendrick C. Boyd; c. William J. Reddin; Albert D. Pearce; d. Edward K. Knots. Teori kepemimpinan tiga dimensi mengemukakan adanya empat gaya dasar kepemimpinan. Tiga dari gaya dasar tersebut adalah : Integrated, related, dan corelated; Dedicated, sparated, dan deserted; Corelated, dedicated, dan integrated; Sparated, integrated, dan related. Gaya kepemimpinan yang efektif menurut teori tiga dimensi hanya dapat dipahami dalam kaitannya dengan : Tujuan yang hendak dicapai; Situasi yang dihadapi; Lingkungan kegiatan; Komposisi bawahan. Gaya kepemimpinan eksekutif dapat terjadi bila pemimpin : Memberi kepercayaan dan kemudahan untuk berkembang kepada bawahan; Mendelegasikan wewenang kepada bawahan untuk mengambil keputusan; Memenuhi kebutuhan anggota dalam menetapkan dan mencapai tujuan serta memperhatikan hubungan antar anggota;

130 Memiliki tatakerja yang berstruktur dan jelas bagi anggotanya. Teori kepemimpinan situasional dikembangkan oleh : Paul Hersey dan Kenneth H. Blanchard; Hemphill dan Coons; Paul Hersey dan Coons; Hemphill dan Kenneth H. Blanchard. Diantara faktor-faktor berikut yang merupakan faktor penting menentukan dalam teori kepemimpinan situasional adalah : Pemimpin; c. Organisasi; Pengikut; d. Tuntutan kerja dan waktu. Teori kepemimpinan situasional berasumsi bahwa hubungan yang efektif antara pemimpin dengan pengikut tergantung pada : Taraf kematangan pengikut dan kemauan pemimpin untuk menyesuaikan orientasinya; Taraf kemampuan pemimpin dan kesediaan pengikut untuk memahaminya; Sifat organisasi dan kesesuaian pengikut dalam organisasi; Sifat organisasi dan kejelasan tuntutan kerja dan waktu. Untuk menentukan gaya kepemimpinan yang cocok pada suatu situasi kegiatan apakah yang pertama-tama harus dilakukan pemimpin menurut teori situasional : Menjelaskan kepada pengikut situasi yang dihadapi organisasi; Menjelaskan tugas-tugas individu atau kelompok dalam organisasi; Mengukur taraf individu atau kelompok yang dipimpin; Mengukur kesediaan pengikut menerima tugas yang diberikan. Gaya kepemimpinan efektif “telling” menurut situasinal adalah : Perilaku pemimpin yang memberikan tekanan tinggi baik pada tugas maupun hubungan; Perilaku pimpinan yang memberikan tekanan tinggi pada hubungan tetapi dengan tugas yang rendah; Perilaku pemimpin yang memberikan tekanan rendah baik pada tugas maupun hubungan; Perilaku pemimpin yang memberikan tekanan tinggi pada tugas tetapi rendah pada hubungan. Produktivitas suatu pekerjaan sebagian besar tergantung pada kemauan pekerja untuk menghasilkan sesuatu. Pernyataan ini merupakan anggapan yang dianut oleh: Teori situasional; c. Teori kontingensi; Teori motivasi; d. Teori Keperilakuan. Teori X dan Teori Y dikembangkan oleh : Frederick Herzberg; c. Dauglas Mc. Gregor; Bernard Mauser; d. Barbara Snyderman. Salah satu asumsi dari teori X adalah : Manusia itu malas bekerja; Manusia tidak memiliki rasa tanggungjawab; Mengendalikan diri itu penting; Manusia itu memiliki rasa tanggungjawab. Salah satu asumsi teori Y adalah : Manusia hanya akan bekerja bila diperintah; Manusia tidak memiliki rasa tanggungjawab; Bekerja pada umumnya sama dengan bermain; Manusia tidak memiliki kemampuan berkreasi. Pemimpin yang mendasarkan tindakannya atas teori cenderung untuk : Memberi kepercayaan kepada bawahan;

131 Membuat tugas dengan jelas dan berstruktur; Mendorong bawahan untuk berinisiatif; Melaksanakan kepemimpinan terbuka. Menurut teori prestasi, motivasi ditentukan oleh tiga kebutuhan yaitu kebutuhan-kebutuhan : Kekuasaan, rasa aman, dan keberhasilan; Rasa aman, keberhasilan, dan kekuasaan; Penghargaan, rasa aman, dan afisiasi; Melaksanakan, afisiasi, dan keberhasilan. Sifat-sifat yang diperlukan pada seorang pemimpin yang efektif, antara lain : Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan dan bersedia melakukan negosiasi; Bertanggungjawab atas pengembangan karir bawahan, dapat menumbuhkan motivasi pada bawahan, dan menghindarkan profesionalisasi tiruan; Mampu memusatkan perhatian, mampu menghadapi dan menangani kegagalan, menghindarkan profesionalisasi tiruan; Bersedia melakukan negosiasi, bertanggungjawab atas pengembangan karir bawahan, dan dapat menumbuhkan motivasi pada bawahan. Ciri-ciri pemimpin yang efektif antara lain : Bersedia melepaskan sebagian wewenangnya kepada bawahan, dan menumbuhkan motivasi bawahan, serta mampu mendorong bawahan mencari jalan pemecahan masalah yang dihadapi; Senang bergaul dengan bawahan, bersedia melepaskan sebagian wewenangnya kepada bawahan, dan dapat menumbuhkan motivasi bawahan; Dapat mengidentifikasi staf yang berbakat, bersedia melepaskan wewenangnya kepada bawahan, dan mampu mendorong bawahan mencari jalan pemecahan permasalahan yang dihadapi; Mau belajar sepanjang hidupnya, mau bergaul dengan bawahan, dan mapu memobilitas bawahan. Tugas kepala sekolah yang paling penting antara lain ; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat dan menyempurnakan kurikulum; Memimpin peningkatan staf sekolah, memelihara hubungan dengan masyarakat, dan mengusahakan timbulnya penghargaan dari murid; Memelihara hubungan dengan petugas-petugas dari instansi, mengusahakan support dari masyarakat, dan bekerja sama dengan bawahan; Berpartisipasi dengan masyarakat dalam berbagai kegiatan, bekerjasama dengan atasan, dan memimpin meningkatkan sekolah. Mengembangkan kesanggupan dan kelebihan pada pada yang dipimpinnya sehingga yang dipimpinnya ini dapat pula menjadi pemimpin. Merupakan tugas dari : Pemimpin; c. Pendidik sebagai pemimpin; Pendidik; d. Pemimpinsebagai pendidik. Pendekatan perilaku (behavioral approach) memandang bahwa kepemimpinan dapat dipelajari dari : Emosi pemimpin yang stabil; Tindakan pemimpin dalam mengambil keputusan; Pendidik yang berwawasan luas; Pemimpin yang mempunyai energi yang kuat. Keterampilan hubungan kemanusiaan (human relation skill) memiliki kekuatan-kekuatan untuk setiap tingkatan/posisi manager, yaitu :

132 Tinggi derajat penguasaannya untuk top manager; Tinggi derajat penguasaannya untuk midlle manager; Rendah derajat penguasaannya untuk lower manager; Sama derajat (tinggi) penguasaannya baik untuk top, midlle, maupun lower manager. Legalitas seorang pemimpin dalam menjalankan kepemimpinanya adalah : Responsibility Power Human Relation Task Oriented Basis kekuasaan yang menggunakan perilaku, tata nilai yang dibentuk dan norma-norma pisitf yang melekat pada diri sendiri sebagai kebiasaan dan pandangan orang lain termasuk ke dalam basis kekuasaan : Coercive Reference Information Reward Kemampuan pemimpin untuk dapat memfasilitasi perubahan dengan kepemilikan visi dan misi organisasi yang harus dimiliki oleh setiap orang adalah pimpinan dengan gaya : Succesfull Colaborative Transformational Democrative Kepala Sekolah adalah “Key Person” di sekolah, kata yang tercetak tebal memiliki pengertian seperti di bawah ini kecuali : Pengambil keputusan Pemimpin sekolah Penerus kekuasaan Pengemban visi sekolah Kekuasaan seorang pemimpin dibatasi oleh variable-variabel kemanusiaan dan variable-variabel yang melekat pada jabatannya, pada intinya kekuasaan seorang pemimpin titik akhirnya adalah dalam bentuk : Kemandirian bawahan Kecemasan bahawan Kepatuhan bawahan Kepuasan bawahan Pemimpin tidak selamanya baik, benar, jurjur dalam perilakunya seperti tuntutan bawahannya, akan tetapi muncul dalam bentuk isitlah pemimpin yang abnormal. Apa yang dimaksud dengan pemimpin abnormal tersebut ? Pemimpin yang memiliki pandangan masa depan yang luas Pemimpin yang memiliki kelebihan dibandingkan dengan yang lainnya dan di luar batas-batas penerimaan bawahannya Pemimpin yang memiliki kelebihan energi pribadinya Pemimpin yang menggunakan kekuasannya di luar batas-batas kekuasaannya. 9. Respon atau balikan terhadap hasil evaluasi

Dokumen Terkait

Bab Iii Metode Penelitian A Pendekatan Penelitian

Bab Iii Metode Penelitian A Pendekatan Penelitian

23 bab iii metode penelitian a pendekatan penelitian pendeka.

Contoh Proposal / 6 kali tayang / 321KB

Tor Lomba Essay 4 Juli 2013 Humasuiacid

Tor Lomba Essay 4 Juli 2013 Humasuiacid

Batas akhir pengiriman esai 17 agustus pukul 2400 wib seleks.

Contoh Proposal / 9 kali tayang / 245KB

Pelajaran 16 Indonesianmalaytextsiinetnetau

Pelajaran 16 Indonesianmalaytextsiinetnetau

Pelajaran 16 jangan peduli dont pay any attention percakapan.

Contoh Proposal / 9 kali tayang / 137KB

Bab I Pendahuluan Repositoryusuacid

Bab I Pendahuluan Repositoryusuacid

Fleksibilitas harga travel rute bandung jakarta di kota band.

Contoh Proposal / 11 kali tayang / 521KB

Pusat Pengajian Siswazah Universiti Tun Hussein Onn Malaysia

Pusat Pengajian Siswazah Universiti Tun Hussein Onn Malaysia

Failure to enclose a complete research proposal may deem you.

Contoh Proposal / 10 kali tayang / 514KB

Pedoman Fipunesaacid

Pedoman Fipunesaacid

Pedoman penulisan skripsi tim penyusun buku pedoman penulisa.

Contoh Proposal / 9 kali tayang / 893KB