Lampiran Keputusan Direktur Penelitian Dan Pengabdian

Keterangan eBook
CreationDate 2014-03-22T12:09:55+07:00
Creator Microsoft Access 2013
Producer Microsoft Access 2013
ModDate 2014-03-22T17:13:10+07:00
Pages 427 Page
Ukuran File 2,624 KB
Dibuka 785 Kali
Topik Contoh Proposal
Tanggal Unggah Wednesday, 16 Nov 2016 - 03:52 AM
Link Unduh
Baca Halaman Penuh BUKA
Rating eBook
Bagi ke Yang Lain


Lampiran Keputusan Direktur Penelitian dan Pengabdian kepada MasyarakatNomor: 0972/E5.1/PE/2014Tentang Penetapan Penerima Penugasan Penerima Hibah Penelitian dan Pengabdian Kepada Masyarakat Tahun 2014I. Daftar Penerima Hibah Penelitian Tahun 2014NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASAMSUL KAMALPengembangan Prototip Micro Hydro in Knockdown Container sebagai Pendorong Kegiatan Indusrti Besi Baja yang Terintegrasi dengan Program Kemandirian Energi1BaruStatus usulan:0023055305UNIVERSITAS GADJAH MADA001001MP3EIKode:ANGGORO CAHYO SUKARTIKOInovasi Indigenous Flavor dan Penjagaan Mutu Produk Menuju Kemandirian Komersial Teh Indonesia2BaruStatus usulan:0520018101UNIVERSITAS GADJAH MADA001001MP3EIKode:BAMBANG RETNOAJI S.Si., M.Sc.PENGELOLAAN POTENSI DAN UPAYA KONSERVASI IN-SITU IKAN WADER PARI (Rasbora lateristriata); BERBASIS PERTUMBUHAN EKONOMI MASYARAKAT, DALAM UPAYA PENGUATAN KETAHANAN PANGAN NASIONAL3BaruStatus usulan:0020107002UNIVERSITAS GADJAH MADA001001MP3EIKode:WIRATNIPengembangan Teknologi Produksi Nano-Chitosan dari Limbah Kulit Udang untuk Pengawetan Ikan di Wilayah Kepulauan Maluku4BaruStatus usulan:0007027304UNIVERSITAS GADJAH MADA001001MP3EIKode:SRI PENI WASTUTININGSIHPerilaku Masyarakat dalam Pengolahan Pangan Lokal sebagai Tujuan Wisata di Kabupaten Lombok Barat Provinsi Nusa Tenggara Barat5BaruStatus usulan:0005026502UNIVERSITAS GADJAH MADA001001MP3EIKode:JOKO NUGROHO WAHYU KARYADIRancang Bangun Mesin Spray Dryer Untuk Pengolahan Gula Bubuk dari Stevia6BaruStatus usulan:0004017003UNIVERSITAS GADJAH MADA001001MP3EIKode:DEENDARLIANTOImplementasi Teknologi Micro-Bubble Generator dan Pengembangan UKM Pengolahan Air Limbah dalam Rangka Meningkatkan Kualitas Air Limbah di Kawasan Industri Jabodetabek Area Menggunakan Bahan Baku Lokal7BaruStatus usulan:0003087203UNIVERSITAS GADJAH MADA001001MP3EIKode:1

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUGIYONO ST, MT, Ph.D.PENGEMBANGAN ALAT TERAPI OKSIGEN HIPERBARIK MULTIPLACE8BaruStatus usulan:0024077102UNIVERSITAS GADJAH MADA001001Riset Andalan Perguruan Tinggi dan IndustriKode:MUSTOFAProduksi dan pemasaran minuman kesehatan Antangin® Vit untuk meningkatkan daya tahan tubuh9BaruStatus usulan:0005016207UNIVERSITAS GADJAH MADA001001Riset Andalan Perguruan Tinggi dan IndustriKode:Prof. Dr. Ir. TEUKU YURI M ZAGLOEL M.Eng. Sc.MODEL PEMBIAYAAN DAN KELEMBAGAAN PROYEK INFRASTRUKTUR KERETA API BANDARA DAN PRASTI TUNNELDENGAN SKEMA KERJASAMA PEMERINTAH SWASTA10BaruStatus usulan:0020036302UNIVERSITAS INDONESIA001002MP3EIKode:Prof., Dr., Ir. ANNE ZULFIA SYAHRIAL M.Sc.Pengembangan Bahan Komposit Aluminium Untuk Blok Rem Kereta Api Sebagai Moda Transportasi Massal Kereta Api Nasional 11BaruStatus usulan:0023036107UNIVERSITAS INDONESIA001002MP3EIKode:Dr. Ir. HAMIDAH HANUM M.P.Pengayaan Kompos Limbah Kelapa Sawit dengan Cendawan Endofit Isolat Lokal untuk Menekan Infeksi Ganoderma spp. dan Peningkatan Produksi di Perkebunan Kelapa Sawit Rakyat di Sumatera Utara12BaruStatus usulan:0002056904UNIVERSITAS SUMATERA UTARA001003MP3EIKode:- ANDI HARIS MUHAMMAD ST. MTPrototipe Desain Kapal Perikanan Ramah Lingkungan untuk Perairan Sulawesi13BaruStatus usulan:0004046902Universitas Hasanuddin001005MP3EIKode:ELMI NURHAIDAH ZPEMANFAATAN RUMPUT LAUT NON-KOMERSIL SEBAGAI BIOKONTROL PENYAKIT “ICE-ICE” PADA BUDIDAYA RUMPUT LAUT Kappahycus alvarezii SEBAGAI UPAYA PENINGKATAN PRODUKSI, SERTA KUANTITAS DAN KUALITAS KARAGINAN14BaruStatus usulan:0018066102Universitas Hasanuddin001005MP3EIKode:Dr.Ir. ADE ROSMANA M.ScPenggunaan mikroorganisme penghuni xylem (MPX) formulasi powder untuk mengendalikan penyakit Fusarium vascular dieback pada tanaman kakao15BaruStatus usulan:0007075703Universitas Hasanuddin001005MP3EIKode:2

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAProf.Dr.Ir. SITTI BULKIS M.SMODEL PENGEMBANGAN KLASTER INDUSTRI KAKAO DI SULAWESI SELATAN 16BaruStatus usulan:0029085401Universitas Hasanuddin001005MP3EIKode:Dr A NIXIA TENRIAWARU SP. M.SiPENGEMBANGAN KOMODITAS BERAS MENUNJANG STOK PANGAN DAN LIBERALISASI PERDAGANGAN: Suatu Inovasi Pengelolaan Teknologi Pertanian Berbasis Masyarakat17BaruStatus usulan:0007117201Universitas Hasanuddin001005MP3EIKode:Dr. SARTINI M.Si., Apt.TEKNOLOGI PENGOLAHAN LIMBAH KULIT BUAH KAKAO : POTENSINYA SEBAGAI SEDIAAN KOMPLEMENTER IMUNOSTIMULAN DAN ANTI HUMAN IMUNODEFICIENCY VIRUS (HIV)18BaruStatus usulan:0011116114Universitas Hasanuddin001005MP3EIKode:Dr.Ir HILAL ANSHARY M.ScProduksi benih udang windu bebas virus pada pembenihan dan pemeliharaannya di tambak dengan pendekatan pengelolaan kesehatan udang secara terpadu, dalam rangka meningkatkan produksi udang windu di Koridor Sulawesi19BaruStatus usulan:0012106701Universitas Hasanuddin001005MP3EIKode:Prof.Dr.Ir. AMRAN M.SiPENGEMBANGAN PRODUKSI SIRUP GLUKOSA DARI BAHAN BAKU TAPIOKAUNTUK MENSUBTITUSI KEBUTUHAN GULA NASIONAL20BaruStatus usulan:0031126307Universitas Hasanuddin001005MP3EIKode:Prof.Dr.Ir. ITJI DIANA DAUD M.SPengembangan dan Penyebaran Benih Jagung Berendofit Beauveria bassiana untuk mengendalikan Penggerek batang (Ostrinia furnacalis)21BaruStatus usulan:0006066002Universitas Hasanuddin001005Riset Andalan Perguruan Tinggi dan IndustriKode:RATU SAFITRIManufaktur Herbal Secang (Caesalpinia sappan) Sebagai Nutraceutical Iron- Chelating Agent Untuk PenderitaThalasemia22BaruStatus usulan:0018036208UNIVERSITAS PADJADJARAN001007MP3EIKode:TAOFIK RUSDIANA S.Si., M.Si., Apt.PEMANFAATAN TANAMAN SELEDRI (APIUM GRAVEOLENS L.) ASAL DAERAH CIWIDEY-JAWA BARAT SEBAGAI PRODUK MINUMAN KESEHATAN BERPOTENSI MEMELIHARA FUNGSI GINJAL23BaruStatus usulan:0030037301UNIVERSITAS PADJADJARAN001007MP3EIKode:3


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANOLDY GUSTAF FRANS MAMANGKEY S.Pi, M.Sc., MODIFIKASI STANDAR PENYISIPAN INTI MUTIARA LEWAT APLIKASI ANASTESI DAN MANTEL REGENERASI PADA PEMBENTUKAN MUTIARA HITAM DI DALAM TUBUH PINCTADA MARGARITIFERA32BaruStatus usulan:0007127002UNIVERSITAS SAM RATULANGI001012MP3EIKode:JOSHIAN NICOLAS W SCHADUWPengembangan Perikanan Marikultur Terpadu Untuk Peningkatan Perekonomian Masyarakat Perbatasan Di Pesisir Kabupaten Kepulauan Sangihe33BaruStatus usulan:0004088402UNIVERSITAS SAM RATULANGI001012MP3EIKode:Dr.Ir. SURIA DARWISITO M.Sc.Pengembangan dan penerapan paket teknologi inovatif dalam bidang budidaya laut di Kabupaten Bolaang Mongondow Selatan34BaruStatus usulan:0028095906UNIVERSITAS SAM RATULANGI001012MP3EIKode:Dr.Ir. AGNES TRIASIH AGUSTIN M.App.ScPengembangan dan penerapan pemanfaatan limbah industri ikan tuna menjadi tepung ikan, gelatin, penyamakan kulit, pupuk organik dan makanan dalam upaya meningkatkan perekonomian masyarakat35BaruStatus usulan:0017085506UNIVERSITAS SAM RATULANGI001012MP3EIKode:Dr. ROIKE IWAN MONTOLALU S.Pi, M.Sc.Pengembangan dan Penerapan Produksi Karaginan Skala Industri Dalam Upaya Meningkatkan Nilai Tambah Ekonomi36BaruStatus usulan:0009037303UNIVERSITAS SAM RATULANGI001012MP3EIKode:WILHELMINA PATTYRestorasi Terumbu Karang Di Taman Nasional Bunaken Provinsi Sulawesi Utara dengan Teknologi Biorock37BaruStatus usulan:0019066404UNIVERSITAS SAM RATULANGI001012MP3EIKode:Dr. Ir. CAROLUS PAULUS PARUNTU M.ScPENGEMBANGAN DAN PENERAPAN SISTIM KAWASAN AGROTECHNO BERBASIS TANPA LIMBAH DI WILAYAH PESISIR DENGAN MENGHASILKAN PRODUK IKAN, SAPI POTONG DAN BIOGAS UNTUK MENINGKATKAN PEREKONOMIAN MASYARAKAT38BaruStatus usulan:0028066703UNIVERSITAS SAM RATULANGI001012MP3EIKode:Dr. FETI FATIMAH M.Si PEMETAAN POTENSI KELAPA DI SULAWESI UTARA SEBAGAI BAHAN BAKU SANTAN KELAPA INSTAN39BaruStatus usulan:0029076802UNIVERSITAS SAM RATULANGI001012MP3EIKode:5

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAProf. Dr. Ir. INDAYATI LANYA M.S.STRATEGI PENENTUAN DAN PENGENDALIAN ALIH FUNGSI LAHAN PERTANIAN DALAM ANTISIPASI DAN PENAGGULANGAN DAMPAK NEGATIF PARIWISATA DI BALI 40BaruStatus usulan:0008095402UNIVERSITAS UDAYANA001013MP3EIKode:Prof. Dr. Drs. MADE KEMBAR SRI BUDHI M.P.Pengembangan Desa Jatiluwih Kecamatan Penebel Kabupaten Tabanan Sebagai Desa Ekowisata Berbasis Masyarakat (Community Based Ecotourism)41BaruStatus usulan:0012025808UNIVERSITAS UDAYANA001013MP3EIKode:Prof.Dr.Ir I WAYAN ARTHANA M.SKajian Komprehensif Produktivitas Usaha Budidaya Rumput Laut di Bali42BaruStatus usulan:0028076002UNIVERSITAS UDAYANA001013MP3EIKode:MARTHEN LUTHER MULLIKPengujian Respon Pertumbuhan Ternak Sapi dan Kualitas Daging Akibat Penggunaan Gulma Chromolaena odorata Sebagai Sumber Protein Dalam Pakan Penggemukan Mendukung MP3EI43BaruStatus usulan:0026046402UNIVERSITAS NUSA CENDANA001014MP3EIKode:RICKY GIMINSuitabilitas Kurungan Setengah-Drum dan Pakan Berbasis Makroalga Lokal untuk Membudidayakan Abalone (Haliotis asinina) di Perairan Timor Barat44BaruStatus usulan:0016086402UNIVERSITAS NUSA CENDANA001014MP3EIKode:I NYOMAN W MAHAYASAPENGEMBANGAN POTENSI BUAH LONTAR MENJADI BERBAGAI JENIS PRODUK DALAM MENUNJANG KERAGAMAN JENIS MAKANAN LOKAL DALAM MENUNJANG KEPARIWISATAAN DI KOTA KUPANG45BaruStatus usulan:0028066508UNIVERSITAS NUSA CENDANA001014MP3EIKode:FRANS GANAPengembangan Koridor Ekowisata Berbasis Potensi Strategis Daerah Di Kabupaten Rote Ndao46BaruStatus usulan:0014066013UNIVERSITAS NUSA CENDANA001014MP3EIKode:MARTHEN R PELLOKILASTRATEGI PENINGKATAN PRODUKTIVITAS INDUK DAN ANAK SAPI BALI MELALUI SUPLEMENTASI PAKAN LOKAL DAN OBAT CACING UNTUK MENDUKUNG SWASEMBADA DAGING NASIONAL47BaruStatus usulan:0017036505UNIVERSITAS NUSA CENDANA001014MP3EIKode:6

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASYAMSUL HIDAYAT DILAGAPemberdayaan Peternak Sapi Sumbawa Dalam Memperbaiki dan Mengelola Pasture untuk Ketahanan Pakan Guna Meningkatkan Produksi Daging dan Susu Nasional48BaruStatus usulan:0001016024UNIVERSITAS MATARAM001016MP3EIKode:BAIQ RIEN HANDAYANI SP. MSi. Ph.DImplementasi Sistim Pengovenan Skala Industri Kecil Menengah Dalam Percepatan Transfer Diversifikasi Pengolahan Dendeng Tradisional Siap Makan Bagi Peningkatan Perekonomian NTB49BaruStatus usulan:0015116803UNIVERSITAS MATARAM001016MP3EIKode:SUKMAWATYPemampaatan teknologi fluidized bed dalam industri pakan ternak berbasis bahan laku lokal dan limbah50BaruStatus usulan:0014126803UNIVERSITAS MATARAM001016MP3EIKode:I WAYAN KARDAKUALITAS KARKAS DAN MARBLING DAGING SAPI BALI DENGAN PEMBERIAN PAKAN BERBASIS KULIT BUAH KAKAO FERMENTASI51BaruStatus usulan:0005094705UNIVERSITAS MATARAM001016MP3EIKode:Ir. ZAINURI PGDip., M.App.Sc., PhD.Evaluasi dan Peningkatan Mutu dan Keamanan Pangan serta Penguatan Kapasitas Kelompok Perempuan Produsen Pangan Lokal untuk Mendukung Pariwisata di Pulau Lombok52BaruStatus usulan:0028076412UNIVERSITAS MATARAM001016MP3EIKode:SUNARPIPengembangan Potensi Produk Pangan Berbasis Peternakan dan Perikanan untuk Menunjang Pariwisata dan Ekonomi Masyarakat di Koridor V Bali – Nusa Tenggara53BaruStatus usulan:0004086205UNIVERSITAS MATARAM001016MP3EIKode:SUPARMINPerubahan Perilaku dan Keseimbangan Ekonomi Rumah Tangga Nelayan Melalui Penerapan Model Minapolitan Rumput Laut Di Pulau Lombok54BaruStatus usulan:0025076005UNIVERSITAS MATARAM001016MP3EIKode:MOHAMMAD HASIL TAMZILPengembangan Ayam Arab sebagai Bahan Baku Ayam Taliwang Rendah Kolesterol untuk Mendukung Wisata Kuliner dan Bahari di Pulau Lombok55BaruStatus usulan:0031126034UNIVERSITAS MATARAM001016MP3EIKode:7

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHENDRY SAKKE TIRA ST., MT.Pemanfaatan Limbah Ternak Sapi Menjadi Biogas Berkualitas Tinggi dalam Menunjang Ekonomi Peternak Sapi serta Menuju NTB Bumi Lumbung Biogas Digester56BaruStatus usulan:0021087304UNIVERSITAS MATARAM001016MP3EIKode:Dr ELSYAN R MARLISSA SE., M.Si.Model Dan Strategi Pembinaan Ketahanan Pangan Masyarakat Tani Etnis Papua Di Distrik Muara Tami57BaruStatus usulan:0012017103UNIVERSITAS CENDERAWASIH001018MP3EIKode:JULIUS ARY MOLLET SE, MBA, MT.Dev, PhDAnalisis Pengembangan Pertanian dan Strategi Peningkatan Ekonomi Masyarakat Lokal di Kabupaten Merauke 58BaruStatus usulan:0014126804UNIVERSITAS CENDERAWASIH001018MP3EIKode:Dr. DANIEL LANTANG M.KesPeningkatan Income Masyarakat Lokal dan Pengelolaan Sumberdaya Pesisir dan Laut Berkelanjutan Melalui Pengembangan Budidaya Teripang dengan Model Sea Farming di Biak Timur dan Kepulauan Padaido Kabupaten Biak Numfor.59BaruStatus usulan:0001086011UNIVERSITAS CENDERAWASIH001018MP3EIKode:Prof.Dr.Ir. LUQMAN HAKIM MS. Peningkatan Mutu Genetik Sapi Bali di Pusat Pembibitan Melalui Seleksi dan Rekording Performans Produksi, serta Perbaikan Kualitas Pakan60BaruStatus usulan:0013125003UNIVERSITAS BRAWIJAYA001019MP3EIKode:BAMBANG SUHARTOPenanganan Gagal Panen Dampak Bulan Kering Pada Produktifas Buah Andalan Jeruk Keprok 55 Kota Batu Dengan Rancang Bangun Irigasi Curah (Sprinkle)61BaruStatus usulan:0009075303UNIVERSITAS BRAWIJAYA001019MP3EIKode:Dr.Drh FAHMIDA MANIN M.PPENGEMBANGAN INDUSTRI PRODUK PROBIOTIK PROBIO_FM BERBASIS KEMITRAAN62BaruStatus usulan:0031086208UNIVERSITAS JAMBI001020MP3EIKode:Dr. SEDERCOR MELATUNAN M.ScMEMASYARAKATKAN USAHA BUDIDAYA IKAN KERAPU BEBEK Chromileptes altivelis HASIL REKAYASA GENETIKA SEBAGAI PENOPANG PEREKONOMIAN KELOMPOK MASYARAKAT NELAYAN MISKIN DI PROVINSI MALUKU63BaruStatus usulan:0030036305UNIVERSITAS PATTIMURA001021MP3EIKode:8

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAM AMIN LASAIBAMODEL SPASIAL KETAHANAN PANGANDALAM PENGEMBANGAN EKONOMI WILAYAHPASCA TRAGEDI KEMANUSIAAN MALUKU64BaruStatus usulan:0016057601UNIVERSITAS PATTIMURA001021MP3EIKode:Ir RADJA B D SORMIN MSiSTATEGI KEMITRAAN DALAM MENINGKATKAN DAYA SAINGUSAHA BUDIDAYA RUMPUT LAUT DI WILAYAH PULAU-PULAU KECIL65BaruStatus usulan:0001086404UNIVERSITAS PATTIMURA001021MP3EIKode:SEMUEL FREDERIK TUHUMURYPENGUATAN EKONOMI MASYARAKAT PULAU SAPARUA MELALUI UPAYA PENGELOLAAN SIPUT LOLA (Trochus niloticus) SECARA TERPADU DAN BERKELANJUTAN66BaruStatus usulan:0028086007UNIVERSITAS PATTIMURA001021MP3EIKode:Dr VITA LAWALATTA SP, MS.iKajian pemanfaatan buah lokal utama di Kabupaten Seram Bagian Barat dan Seram Bagian Timur untuk pembuatan fruit leather 67BaruStatus usulan:0020117203UNIVERSITAS PATTIMURA001021MP3EIKode:Dr. SHERLY MIEKE PATTIPEILUHU M.ScStrategi peningkatan produksi budidaya ikan melalui inovasi penanganan penyakit dengan teknologi modulasi pakan prebiotik68BaruStatus usulan:0016105912UNIVERSITAS PATTIMURA001021MP3EIKode:Prof. Dr. THOMAS PENTURY M.SiAnalisis Kinerja Penelitian Bidang Pangan Wilayah Papua dan Kepulauan Maluku dalam Kerangkan MP3EI69BaruStatus usulan:0017056305UNIVERSITAS PATTIMURA001021MP3EIKode:MARIA NINDATUPotensi Biji Lamun (Enhalus acaroides) Sebagai Sumber Makanan Kesehatan : Upaya Peningkatan Imunitas dan Ekonomi Masyarakat Pesisir di Maluku.70BaruStatus usulan:0027096403UNIVERSITAS PATTIMURA001021MP3EIKode:DR Ir O TONNY S ONGKERS MSPotensi, Status dan Pengembangan Perikanan Udang Karang Panulirus sp. di Maluku Tengah dan Seram Bagian Barat:Peningkatan Kapasitas Pengelolaan Sumberdaya Perikanan dan Penguatan Ekonomi Nelayan 71BaruStatus usulan:0025106106UNIVERSITAS PATTIMURA001021MP3EIKode:9

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADr. ERYNOLA MONIHARAPON Aplikasi Antibakterial Alami Bubuk Atung (Parinarium glaberrimum Hassk)Kemas Pada Tuna Loin Ekspor dalam Meningkatkan Pendapatan Nelayan Tuna Maluku72BaruStatus usulan:0005117106UNIVERSITAS PATTIMURA001021MP3EIKode:Ir APHRODITE M SAHUSILAWANE MSKEARIFAN LOKAL PETANI PEREMPUAN MENJAGA PANGAN DI PULAU-PULAU KECIL (STUDI KASUS SUKU MEHER DI PULAU KISAR KABUPATEN MALUKU BARAT DAYA)73BaruStatus usulan:0001075504UNIVERSITAS PATTIMURA001021MP3EIKode:SIMON TUBALOWONYPeningkatan Ekonomi Rumah Tangga Perikanan Demersal melalui Penerapan Teknologi Alternatif pada Gugus Pulau VII Provinsi Maluku74BaruStatus usulan:0018106703UNIVERSITAS PATTIMURA001021MP3EIKode:Dr. Ir. RADIAN M.S.MODEL PENGEMBANGAN TANAMAN JABON MELALUI SISTEM AGROFORESTRI SECARA BERKELANJUTAN DI TANAH GAMBUT 75BaruStatus usulan:0015126005UNIVERSITAS TANJUNGPURA001022MP3EIKode:RUDIYANSYAH S.Si.M.Si,Ph.DPROUKSI BIODIESEL DARI CRUDE PALM OIL (CPO) MENGGUNAKAN KATALIS HETEROGEN BIFUNGSIONAL76BaruStatus usulan:0024017205UNIVERSITAS TANJUNGPURA001022MP3EIKode:Prof. Dr. GARUDA WIKO S.H., M.Si.REKONSTRUKSI SOSIAL MASYARAKAT DISEKITAR PERKEBUNAN SAWIT MELALUI PENDEKATAN HUKUM PROGRESSIF DI DESA LALANG KECAMATAN TAYAN HILIR KABUPATEN SANGGAU77BaruStatus usulan:0028016503UNIVERSITAS TANJUNGPURA001022MP3EIKode:Dr. Ir. BURHANUDDIN M.P.Pengembangan IPTEK Penanaman Jabon (Anthocephalus spp) pada Tanah Masam Guna Percepatan Ekonomi Masyarakat Perbatasan Kalimantan Barat 78BaruStatus usulan:0014115911UNIVERSITAS TANJUNGPURA001022MP3EIKode:Dr. Dra. NETTY HERAWATI M.Si.Pengembangan Model Pemberdayaan Ekonomi Masyarakat Lokal Sebagai Bentuk Komunikasi Sosial Untuk Mengantisipasi Munculnya Konflik Petani Dengan Perusahaan Guna Mendukung Pembangunan Perkebunan Kelapa Sawit Berkelanjutan Di Kawasan Perbatasaan Kalimantan79BaruStatus usulan:0029106501UNIVERSITAS TANJUNGPURA001022MP3EIKode:10

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADr. Ir. DENAH SUSWATI M.P.PENGELOLAAN LAHAN GAMBUT BERKELANJUTAN DENGAN PEMANFAATAN LUMPUR LAUT DAN PENGENDALIAN MUKA AIR TANAH DALAM MENINGKATKAN PRODUKSI KEBUN SAWIT RAKYAT80BaruStatus usulan:0030056508UNIVERSITAS TANJUNGPURA001022MP3EIKode:Ir. WIWIK EKYASTUTI M.SiOptimalisasi pemanfaatan indigenous species untuk reklamasi lahan bekas tambang emas rakyat melalui pemberdayaan masyarakat untuk penguatan ekonomi lokal81BaruStatus usulan:0010056808UNIVERSITAS TANJUNGPURA001022MP3EIKode:Prof. Dr. Ir. SAERI SAGIMAN M.ScBiomanajemen Lahan Pasca Tambang Emas Rakyat untuk Mendukung Industri Perkayuan di Kalimantan Barat82BaruStatus usulan:0001015215UNIVERSITAS TANJUNGPURA001022MP3EIKode:Dr., Drs. SUDARTO M.ESTRATEGI PENDAMPINGAN PENGEMBANGAN KAWASAN RUMAH PANGAN LESTARI DI KABUPATEN BANJARNEGARA BERBASIS SYARIAH UNTUK MENUJU KEMANDIRIAN EKONOMI83BaruStatus usulan:0019076206UNIVERSITAS JENDERAL SOEDIRMAN001023MP3EIKode:NINA YULIANTI SP.,MP.Pengembangan Teknologi Fire Early Warning Terintegrasi Untuk Agroekosistem Kelapa Sawit Berkelanjutan di Lahan Gambut84BaruStatus usulan:0030068201UNIVERSITAS PALANGKA RAYA001024MP3EIKode:Prof. Dr. I NYOMAN SUDYANA M.Sc.Reklamasi Eks Galian Tambang Batu Bara Melalui Budidaya dan Pemanfaatan Tumbuhan Kamandrah (Croton tiglium L) Sebagai Bahan Baku Biodiesel85BaruStatus usulan:0018026208UNIVERSITAS PALANGKA RAYA001024MP3EIKode:KACUNG HARIYONOKajian Kesiapan Klaster dan Rancang Bangun Model Pemberdayaan Supply-Chain ‘Agroindustri Intermediate Singkong’ di Jawa Timur Sebagai Basis Industri Pangan Alternatif Nasional86BaruStatus usulan:0014086405UNIVERSITAS JEMBER001025MP3EIKode:Dr. Ing. MELVI S.T., M.T.Smart City - Smart Mobility: Platform Pengembangan Kota Berbasis Teknologi Informasi Terpadu Pada Kawasan Strategis Nasional Selat Sunda87BaruStatus usulan:0018017301UNIVERSITAS LAMPUNG001026MP3EIKode:11

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATULUS HARYONOAkselerasi Bisnis Konveksi Batik Melalui Pengembangan Manajemen Industri Kreatif untuk Mendukung Percepatan Pembangunan Perekonomian Wilayah Surakarta88BaruStatus usulan:0001085510UNIVERSITAS SEBELAS MARET001027MP3EIKode:MULYANTODesain pola motif tekstil bermotif sebagai upaya pemberdayaan industri89BaruStatus usulan:0012076303UNIVERSITAS SEBELAS MARET001027MP3EIKode:MIFTAHUL ANWARPengembangan Material Berbasis Karbon Untuk Peningkatan Kualitas Produk Usaha Rumah Tangga Pande Besi Koripan Klaten Sebagai Penguat Industri Makanan90BaruStatus usulan:0624038303UNIVERSITAS SEBELAS MARET001027MP3EIKode:SUHERMANPEMULIHAN DAN PENINGKATAN BUAH KAKAO DENGAN CARAPEMBERIAN SUPLEMEN UNSUR HARA DARI TONASINYA YANG DIBLENDING DENGAN KITOSAN SERTA PEMANFAATANNYA UNTUK BISKUIT-KRIPIK (BISPIK)91BaruStatus usulan:0031125635UNIVERSITAS TADULAKO001028MP3EIKode:Dr. Ir. GATOT SISWO HUTOMO MPTeknik Pengolahan Pod Husk Kakao sebagai bahan Pangan92BaruStatus usulan:0016115705UNIVERSITAS TADULAKO001028MP3EIKode:SAHARUDDINSTRATEGI PEMBERDAYAAN EKONOMI MASYARAKAT BERBASIS KEWIRAUSAHAAN PADA KAWASAN TAMBANG NIKEL SECARA SINERGIS MELALUI OPTIMALISASI PEMANFAATAN CORPORATE SOCIAL RESPONSIBILITY (CSR) DI KORIDOR IV SULAWESI(Survei di Kabupaten Morowali, Pomalaa, dan Sorowa93BaruStatus usulan:0010096309UNIVERSITAS TADULAKO001028MP3EIKode:HAERUL ANAMStrategi Peningkatan Produksi Dan Pemasaran Komoditas Kedelei Di Daerah Transmigrasi Jawa-Sunda Dataran Bulan Sebagai Upaya Perbaikan Pendapatan Petani di Kabupaten Tojo Una-Una Provinsi Sulawesi Tengah94BaruStatus usulan:0030036207UNIVERSITAS TADULAKO001028MP3EIKode:Dr. MAPPIRATU MSPotensi Omega3,6 dan 9 Alami Sebagai Sumber Pangan Fungsional dariCampuran Minyak Ikan Tongkol (Euthynnus spp) dan Ikan Lele (Clarias sp)di Perairan Provinsi Sulawesi Tengah95BaruStatus usulan:0007075310UNIVERSITAS TADULAKO001028MP3EIKode:12

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMOHAMMAD NOVAL LSTUDI PENGEMBANGAN SISTEM LOGISTIK IKAN SULAWESI TENGAH DALAM MENDUKUNG TERWUJUDNYA SISTEM LOGISTIK IKAN NASIONAL (SLIN)96BaruStatus usulan:0007036904UNIVERSITAS TADULAKO001028MP3EIKode:Dr. Eng ANDI RUSDIN S.T., M.T., M.Sc.PEMETAAN ZONA KERENTANAN AIRTANAH (Mapping Groundwater Vulnerability Zone) PADA PERTAMBANGAN NIKEL KABUPATEN MOROWALI DI PROPINSI SULAWESI TENGAH97BaruStatus usulan:0003037103UNIVERSITAS TADULAKO001028MP3EIKode:PATTA TOPEStrategi pengembangan kawasan teluk tomini berbasis perikanan dalam rangka percepatan pertumbuhan ekonomi masyarakat pesisir di sulawesi tengah98BaruStatus usulan:0005096514UNIVERSITAS TADULAKO001028MP3EIKode:HILDA MONOARFA SE.,M.SiPeningkatan Nilai Tambah Dan Pendapatan Nelayan Tangkap Berbasis Tepung Ikan Untuk Meraih Potensi Pasar Pakan Ternak Unggas Sebagai Upaya Mengurangi Ketergantungan Impor Tepung Ikan Di Indonesia. (Survey Di Sentra Produksi Kabupaten Tojo Una-Una Sulawe99BaruStatus usulan:0026107105UNIVERSITAS TADULAKO001028MP3EIKode:Prof. Dr. Ir ALAM ANSHARY MSiPengendalian Penggerek Buah Kakao Terintergrasi di Perkebunan Rakyat100BaruStatus usulan:0001125808UNIVERSITAS TADULAKO001028MP3EIKode:Prof. Dr. SYAHIR NATSIR SE, M.SiRENCANA STRATEGIS PENGELOLAAN AGRIBISNIS RUMPUT LAUT BERBASIS MASYARAKAT MELALUI AGROINDUSTRI SRC DAN AGAR SERTA PEMBERDAYAAN MASYARAKAT DI PROVINSI SULAWESI TENGAH101BaruStatus usulan:0014056306UNIVERSITAS TADULAKO001028MP3EIKode:Dr. LA KARIMUNA M.Sc.Agr.PENGEMBANGAN TANAMAN KACANG TANAH VARIETAS LOKAL UNGGUL DENGAN APLIKASI BIOTEKNOLOGI BOKASI PLUS BERBASIS SUMBER DAYA LOKAL PADA LAHAN KERING MARGINAL102BaruStatus usulan:0031126328UNIVERSITAS HALUOLEO001029MP3EIKode:ENDRO SUKOTJORekayasa Kelembagaan Untuk Meningkatkan Nilai Tambah Biji Kakao di Kabupaten Konawe Selatan103BaruStatus usulan:0029016208UNIVERSITAS HALUOLEO001029MP3EIKode:13

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADr. Ir. Weka Widayati M.SAPLIKASI MODEL PEMBERDAYAAN MASYARAKAT BERBASIS PENGHIDUPAN BERKELANJUTAN (SUSTAINABLE LIVELIHOOD) DAN PENGEMBANGAN COCOA VILLAGE PADA PETANI KAKAO DI KOLAKA TIMUR104BaruStatus usulan:0050864111UNIVERSITAS HALUOLEO001029MP3EIKode:AGUS KURNIA S.Pi. M.Si. Ph.DPeningkatan produksi lobster laut melalui pemberian pakan "sehat" dalam mendukung pengembangan budidaya laut berkelanjutan di Koridor Ekonomi Sulawesi105BaruStatus usulan:0001087005UNIVERSITAS HALUOLEO001029MP3EIKode:Ir LA SARA M.Si., Ph.D.Rancangan Manajemen Perikanan Kepiting Rajungan (Portunus pelagicus) Untuk Mempertahankan Populasinya Secara Berkelanjutan dan Meningkatkan Pendapatan Nelayan di Wilayah Perairan Sulawesi Tenggara106BaruStatus usulan:0022046109UNIVERSITAS HALUOLEO001029MP3EIKode:ISHAK AWALUDDINRENCANA INDUK PENGEMBANGAN TERPADU DAN BERKELANJUTAN UMKM BERBASIS PERIKANAN SEBAGAI UPAYA PENINGKATAN KESEJAHTERAAN DAN PERCEPATAN PEMBANGUNAN DAERAH TERTINGGAL DI SULAWESI TENGGARA107BaruStatus usulan:0029055912UNIVERSITAS HALUOLEO001029MP3EIKode:MUNTU ABDULLAH SE., M.Si.Masterplan Pengembangan Klaster Industri dan Inovasi Produk Berbasis Rumput Laut dalam Upaya Percepatan dan Perluasan Pembangunan Daerah pesisir di Sulawesi Tenggara108BaruStatus usulan:0017096506UNIVERSITAS HALUOLEO001029MP3EIKode:Dr. LA ODE GEO M.SKAJIAN EKONOMI TENTANG PRODUK UNGGULAN STRATEGIS NON BERAS DALAM PERCEPATAN DAN PERLUASAN PEMBANGUNAN PERTANIAN TANAMAN PANGAN DI PROVINSI SULAWESI TENGGARA109BaruStatus usulan:0005105514UNIVERSITAS HALUOLEO001029MP3EIKode:PRASETYOModel Rehabilitasi Kawasan Hutan Lindung Berbasis Agroforestry Karet Intensif untuk Membangun Hutan Kemasyarakatan di Propinsi Bengkulu110BaruStatus usulan:0026075808UNIVERSITAS BENGKULU001030MP3EIKode:HENDRAWANAmiliorisasi Performa, Pabrikasi dan Komersialisasi Bionutrien: Upaya Penyediaan Material Pendukung Praktik Pertanian Ramah Lingkungan 111BaruStatus usulan:0011096307UNIVERSITAS PENDIDIKAN INDONESIA001034Riset Andalan Perguruan Tinggi dan IndustriKode:14


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAProf. Dr. TRI MARHAENI PUDJI ASTUTI M.Hum.Strategi Pemerataan Pendidikan Dan Penguatan Ekonomi Sektor Pariwisata Dan Pertanian Melalui Program Sarjana Mendidik Di Daerah Terdepan, Terluar, Tertinggal (SM-3T)120BaruStatus usulan:0009066504UNIVERSITAS NEGERI SEMARANG001041MP3EIKode:Dr. SUCIHATININGSIH DIAN WISIKA P M.Si.MODEL “FREEZING-FRYING” DALAM PENGOLAHAN BUAH - SAYUR PASCA PANEN BERJANGKA PANJANG DAN POLA PEMBERDAYAAN SINERGIS PETANI - INDUSTRI121BaruStatus usulan:0009126806UNIVERSITAS NEGERI SEMARANG001041MP3EIKode:MEUTIA SE., MP.Pengembangan Kompetensi Wirausaha dan Diversivikasi Produk untuk Mendorong Daya Saing dan Keberhasilan Industri Kecil di Provinsi Banten122BaruStatus usulan:0028087207UNIVERSITAS SULTAN AGENG TIRTAYASA001042MP3EIKode:DR IRHAM HI IKSAN S.Pi,M.SiSumberdaya Alam di Pesisir Desa Guruaping/Desa Bajo, Maluku Utara123BaruStatus usulan:0003127903UNIVERSITAS KHAIRUN001044MP3EIKode:Dr SOFYAN SAMAD S.P.,M.SiPENGEMBANGAN TEKNOLOGI BUDIDAYA UBI KAYU (Manihot esculenta Crantz ) BERBASIS ORGANIK UNTUK MENINGKATKAN DIVERSIFIKASI BAHAN PANGAN124BaruStatus usulan:0015087010UNIVERSITAS KHAIRUN001044MP3EIKode:NAM RUMKELPENGEMBANGAN MODEL KEBIJAKAN ENERGI ALTERNATIF BERBASIS POTENSI LOKAL DI KABUPATEN HALMAHERA BARAT,PROPINSI MALUKU UTARA125BaruStatus usulan:0013067403UNIVERSITAS KHAIRUN001044MP3EIKode:Dr RUSDIN ALAUDDIN MHModel Penyelesaian Sengketa Lahan Akibat Usaha Pertambangan Nikel di Provinsi Maluku Utara126BaruStatus usulan:0012017305UNIVERSITAS KHAIRUN001044MP3EIKode:DR ALIANTO S.Pi, M.SiPeningkatan Pendapatan Nelayan Melalui Penyediaan Sistem Informasi Daerah dan Waktu Penangkapan Ikan Tuna yang Adaptif Terhadap Perubahan Iklim di Kepala Burung Papua127BaruStatus usulan:0005037005UNIVERSITAS NEGERI PAPUA001045MP3EIKode:16

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHENDRIModel Intensifikasi Umbi-Umbian Lokal untuk Menjamin Ketersediaan Pangan pada Kondisi Cuaca Ekstrim di Papua Barat128BaruStatus usulan:0029117301UNIVERSITAS NEGERI PAPUA001045MP3EIKode:EKO AGUS MARTANTOPeningkatan Produksi Ubijalar Melalui Pemanfaatan Pupuk Organik dan Cendawan Trichoderma sp129BaruStatus usulan:0029026804UNIVERSITAS NEGERI PAPUA001045MP3EIKode:BERTHA MANGALLOPeningkatan Produksi dan Kualitas Pati Sagu Melalui Pemanfaatan Tailing dan Pupuk Kandang Sebagai Nutrisi dan Amelioran 130BaruStatus usulan:0917097001UNIVERSITAS NEGERI PAPUA001045MP3EIKode:Dr. M. SAYUTI S.T., M.Sc.Model Pemberdayaan Masyarakat Sekitar Tambang Batubara Berbasis Sinergisitas Stakeholder dan Manajemen Ekoregion Untuk Menggerakkan Ekonomi Rakyat di Provinsi Aceh131BaruStatus usulan:0030087202UNIVERSITAS MALIKUSSALEH001046MP3EIKode:SAIFUDDIN S.PdI., M.A.Kebijakan Pemberdayaan Ekonomi Masyarakat Melalui Komoditi Sawit Di Kabupaten Aceh Timur132BaruStatus usulan:0020077906UNIVERSITAS MALIKUSSALEH001046MP3EIKode:Dr. Ir. SYAMSUDDIN MP.Strategi Pemgembangan Perikanan Tangkap Berkelanjutan dan Ramah Lingkungan di Provinsi Gorontalo133BaruStatus usulan:0001036809UNIVERSITAS NEGERI GORONTALO001047MP3EIKode:MUHAMMAD AMIR ARHAM S.Pd, MEMenciptakan Nilai Tambah dan Perluasan Pemasaran Komoditas Ikan Teri di Kabupaten Gorontalo Utara134BaruStatus usulan:0025077203UNIVERSITAS NEGERI GORONTALO001047MP3EIKode:Prof. Dr. ANI M HASAN M.PdPemberdayaan Petani Melalui Pengolahan Jagung dan Limbah Jagung Menjadi Komoditas Ekonomi Produktif di Kabupaten Boalemo Provinsi Gorontalo135BaruStatus usulan:0020086606UNIVERSITAS NEGERI GORONTALO001047MP3EIKode:17

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAProf.Dr. ANAK AGUNG GEDE AGUNG M.PdPengembangan Model Wisata Edukasi - Ekonomi Berbasis Industri Kreatif Berwawasan Kearifan Lokal Untuk Meningkatkan Ekonomi Masyarakat136BaruStatus usulan:0020055604UNIVERSITAS PENDIDIKAN GANESHA001048MP3EIKode:TRIANASARI M.MPengembangan Dan Implementasi Model Pemetaan Distribusi Dana Corporate Social Responsibility Untuk Menjaga Kelestarian Objek Wisata Di Bali137BaruStatus usulan:0006067005UNIVERSITAS PENDIDIKAN GANESHA001048MP3EIKode:Dr.Ir. IAN JOSEF MATHEUS EDWARD MTPengembangan Aplikasi Real Time Monitoring Data Sumber Daya Laut untuk Meningkatkan Potensi Wilayah138BaruStatus usulan:0006116802INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:LILIK HENDRADJAJAPenciptaan magister bidang strategis dari sarjana sains dasar melalui program pra S2 (matrikulasi alih bidang tetap linier) sainstek untuk dosen prodi S2 bidang strategis (suatu terobosan)139BaruStatus usulan:0001084902INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:Dr. RAJESRI ST,MTPengembangan Sektor Telematika Indonesia melalui Peningkatan Kapabilitas Layanan Offshore Outsourcing IT Perusahaan Perangkat Lunak Indonesia140BaruStatus usulan:0012107002INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:Ir. ADI INDRAYANTO M.Sc.,Ph.D.Sistem Komunikasi Lokal Daerah Rural Berbasiskan Teknologi Broadband Wireless Access (BWA)141BaruStatus usulan:0010016403INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:PLATO MARTUANI SIREGARPengembangan Sistem Informasi Kalender Tanam Padi Resolusi Tinggi untuk Peningkatan Kapasitas Petani142BaruStatus usulan:0031017001INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:Dr. BAMBANG RUDITO M.Si.Model Pengembangan Organisasi Pemerintah dan Desain Kompetensi Jabatan143BaruStatus usulan:0013015905INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:18

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADJAROT WIDAGDOPENGGUNAAN TEKNIK KORELASI CITRA DIJITAL UNTUK MENGUKUR TEGANGAN JEMBATAN KERETA API CIKUBANG SEBAGAI BAGIAN REMAINING LIFE ASSESSMENT144BaruStatus usulan:0027097010INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:IPING SUPRIANA SUWARDIPengembangan Teknologi Pengelolaan Data Spasialuntuk Model Korporasi pada Platform Google Maps145BaruStatus usulan:0013065201INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:PRADONOModel Pemberdayaan Ekonomi Masyarakat melalui Pariwisata146BaruStatus usulan:0022036401INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:Dr. Ir. JAKA SEMBIRING M.Eng.Penerapan dan Implementasi Teknologi Virtual Class untuk Daerah Rural147BaruStatus usulan:0028026601INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:SUGIHARTONORANCANG BANGUN DAN IMPLEMENTASI PASSIVE MULTISTATIC SOFTWARE DEFINED RADAR SYSTEM148BaruStatus usulan:0002064901INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:RINALDIPerancangan dan Implementasi Sistem Keamanan Data untuk Radar149BaruStatus usulan:0010126501INSTITUT TEKNOLOGI BANDUNG002001MP3EIKode:Dr. NUR ULFA MAULIDEVI S.T., M.Sc.Sistem Cerdas untuk Online Monitoring System pada Diesel Engine (Motor Bakar Torak Penyalaan Kompresi) Ukuran Besar150BaruStatus usulan:0009037605INSTITUT TEKNOLOGI BANDUNG002001Riset Andalan Perguruan Tinggi dan IndustriKode:Dr. Eng JANUARTI JAYA EKAPUTRI ST,MT.GEOPAV DAN GEOBATA: PAVING DAN BATA BERBAHAN SEMEN GEOPOLIMER DARI FLY ASH LIMBAH PABRIK151BaruStatus usulan:0012017408Institut Teknologi Sepuluh Nopember002002Riset Andalan Perguruan Tinggi dan IndustriKode:19


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADipl. Ing NOVAL LILANSA M.T.Pengembangan Mesin Pembakaran Dalam Berbahan Bakar Gas dengan Konfigurasi Pembakaran Berdaya Ganda melalui Sistem Injeksi Pintar160BaruStatus usulan:0023117101POLITEKNIK MANUFAKTUR BANDUNG005001Riset Andalan Perguruan Tinggi dan IndustriKode:Dr, Drs. A SUTOWO LATIEF M.Si.Pengembangan Pembuatan Gula Tumbu Mutu I Dalam Skala Usaha Mikro Melalui Metode Fosfatasi, Dicetak Menjadi Gula Butiran Dan Dikemas Vakum Untuk Memenuhi Permintaan Ekspor 161BaruStatus usulan:0028035101POLITEKNIK NEGERI SEMARANG005005MP3EIKode:BAMBANG SUPRIYO BSEE, M. Eng. Sc.Rancang Bangun Sistem Deteksi Dini Aktivitas Gunung Merapi Menggunakan Teknologi Jaringan Sensor Nirkabel 162BaruStatus usulan:0007076304POLITEKNIK NEGERI SEMARANG005005MP3EIKode:SURYANTOOptimasi Oscillatory Flow Reactor Untuk Meningkatkan Produksi Biodiesel Sistim Kontinyu 163BaruStatus usulan:0026085904POLITEKNIK NEGERI UJUNG PANDANG005012MP3EIKode:Dr. Ir. KASUTJIANINGATI M.SiPengembangan Industri Makanan Siap Saji Berbasis Pemanfaatan Limbah Pertanian Sebagai Bahan Dasar Media Tumbuh Jamur Tiram (Pleourotus sp)164BaruStatus usulan:0011105603POLITEKNIK NEGERI JEMBER005019MP3EIKode:Dr. Ir DAHLIA M.PStrategi Produksi Udang Galah (Macrobrachium rosenbergii) Jantan Secara Berkelanjutan untuk Mendukung Pembangunan Ekonomi Masyarakat di Sulawesi Selatan.165BaruStatus usulan:0031126649POLITEKNIK PERTANIAN NEGERI PANGKAJENE KEPULAUAN005020MP3EIKode:NUR RAHMAWATY ARMAPengembangan Pembenihan dan Sentra Bisnis Ikan Gabus (Channa striata) untuk Penguatan Ekonomi Masyarakat166BaruStatus usulan:0007067102POLITEKNIK PERTANIAN NEGERI PANGKAJENE KEPULAUAN005020MP3EIKode:Ir SITTI NURMIAH M.SiPenerapan Teknologi Alkali Treated Cottonii untuk Peningkatan Proses dan Mutu Produk Olahan Rumput Laut Petani Dalam Rangka Peningkatan Ekonomi Nasional167BaruStatus usulan:0005016706POLITEKNIK PERTANIAN NEGERI PANGKAJENE KEPULAUAN005020MP3EIKode:21

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADr. Ir DARMAWAN M.POptimalisasi dan Pengembangan Bisnis Pembibitan dan Kebun Entris Klon Unggul Sulawesi yang Terintegrasi dengan Produk Skunder Sinergi Kakao-Sapi168BaruStatus usulan:0002026711POLITEKNIK PERTANIAN NEGERI PANGKAJENE KEPULAUAN005020MP3EIKode:S.Pi MARTHA RETTOB M.SiPEMANFAATAN CACING LAWAR SEBAGAI BAHAN BAKU UNGGULAN FORMULA PAKAN IKAN DI KABUPATEN MALUKU TENGGARA169BaruStatus usulan:0030117203POLITEKNIK PERIKANAN NEGERI TUAL005022MP3EIKode:Dr. INDAH MARTATI SE.MMStrategi Percepatan Pertumbuhan Sentra Perekonomian Berbasis Usaha Kerakyatan Melalui Optimalisasi Peran CRS Sektor Pertambangan Batu Bara170BaruStatus usulan:0030116503Politeknik Negeri Samarinda005026MP3EIKode:AMALIA ST.MTPenyebaran Informasi Dan Motivasi Pemberian ASIEksklusif Kepada Para Ibu Menyusui Dengan Memanfaatkan Jaringan Ponsel171BaruStatus usulan:0121127801UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:RAHMI DWI HANDAYANI RAMBE SP.MP.RESPONS PERTUMBUHAN DAN PRODUKSI JAGUNG MANIS (Zea mays saccharata L.)TERHADAP PEMBERIAN PUPUK ORGANIK DAN PUPUK AN ORGANIK172BaruStatus usulan:0117127801UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:DESI NOVITA S.P., M.SiPeranan Investasi Sektor Perkebunan Kelapa Sawit terhadap Perekonomian Sumatera Utara (Pendekatan Analisis Input-Output) 173BaruStatus usulan:0002118009UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:S.Si LISA ARIYANTI POHAN MPdPERANAN MODEL PEMBELAJARAN INTEGRATIF DAN SIKAP SISWA PADA PELAJARAN KIMIA TERHADAP HASIL BELAJAR KIMIA SISWA SMA AN NIZAM MEDAN174BaruStatus usulan:0004127703UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:SYAM SAFITRI SP.MPUji Potensi Jamur Endofit Tanaman Karet sebagai Biofungisida terhadap Patogen Penyakit Gugur Daun Colletotrichum175BaruStatus usulan:0116037301UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:22

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADIAN HENDRAWAN SP.MMAFaktor-Faktor yang Mempengaruhi Kinerja Penyuluh Di Kabupaten Deli Serdang dan Langkat Provinsi Sumatera Utara176BaruStatus usulan:0114077201UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:Drs SULARNO MPKeragaman Entomopatogenik Fungi Lokal dan Pemanfaatannya untuk Menjaga Kwalitas Sayuran Organik Brastagi177BaruStatus usulan:0012036704UNIVERSITAS ISLAM SUMATERA UTARA011001Penelitian Dosen PemulaKode:RANI FARIDA SINAGAPENERAPAN GEOGEBRA SEBAGAI ALTERNATIF MEDIA PEMBELAJARAN UNTUK MENINGKATKAN AKTIVITAS DAN HASIL BELAJAR PADA MATA KULIAH GEOMETRI DI PRODI PENDIDIKAN MATEMATIKA UNIVERSITAS HKBP NOMMENSEN TAHUN AJARAN 2013/2014178BaruStatus usulan:0130058603UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:HENDRIK L SIMANJUNTAKKomposisi Piano Klasik Indonesia: Analisis Struktur Musik “Indyhiang” Karya Amir Pasaribu179BaruStatus usulan:0129077902UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:JENNY MIRONY BR SIMANJUNTAK SE., MM.PENGKAJIAN BENTUK BUDAYA ORGANISASI DAN KARAKTERISTIK PEMIMPIN DALAM UPAYA PENERAPAN KEDISIPLINAN DAN DAMPAKNYA TEHADAP KINERJA PEGAWAI NEGERI SIPIL : STUDI PADA BADAN PEMBERDAYAAN MASYARAKAT DAN PEMERINTAHAN DESA PROVINSI SUMATERA UTARA180BaruStatus usulan:0108017601UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:RUTMMAYASARI SIMANJUNTAKInovasi Model Pencapaian Konsep untuk Meningkatan Kemampuan Pemahaman Dan Kreativitas Matematika Di FKIP Universitas HKBP Nommensen Medan.181BaruStatus usulan:0122068303UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:BESLINA AFRIANI SIAGIANPENERAPAN MODEL NATURE OF SCIENCE TERHADAP KETERAMPILAN MENULIS PROPOSAL SKRIPSI DALAM MATA KULIAH METODOLOGI PENELITIAN FKIP UNIVERSITAS HKBP NOMMENSEN MEDAN TAHUN AJARAN 2013/ 2014182BaruStatus usulan:0123048802UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:Ir ROSNAWYTA SIMANJUNTAK MPKarakteristik Mi Basah yang disubtitusi dengan Tepung Rumput Laut dan Tepung Labu Kuning183BaruStatus usulan:0130116803UNIVERSITAS HKBP NOMMENSEN011002Penelitian Dosen PemulaKode:23


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs. ALINAPIA MHKEDUDUKAN IBUKOTA KABUPATENSETELAH TERJADINYA PEMEKARANDAERAH (Studi Ibukota Tapanuli SelatanSetelah Menjadi Pemerintah KotaPadangsidimpuan).192BaruStatus usulan:0113016501UNIVERSITAS MUHAMMADIYAH TAPANULI SELATAN011014Penelitian Dosen PemulaKode:SRI MULIATIKPengaruh Model Pembelajaran Berbasis Masalah dan Tingkat Intelegensi Terhadap Keterampilan Menulis Argumen Siswa SMP di Kecamatan Deli Tua193BaruStatus usulan:0122057602UNIVERSITAS ALWASHLIYAH011017Penelitian Dosen PemulaKode:SUTANTI M.SiANALISIS SEKTOR UNGGULAN DI KOTA MEDAN DENGAN METODE LOCATION QUOTION DAN SHIFT SHARE SEBAGAI PENENTU PRIORITAS PEMBANGUNAN DAERAH194BaruStatus usulan:0130128502UNIVERSITAS ALWASHLIYAH011017Penelitian Dosen PemulaKode:RISNA MIRA BELLA SARAGIHPerbedaan Peningkatan Kemampuan komunikasi dan Koneksi Matematis Siswa Dengan Pendekatan Kooperatif Tipe STAD Berbantuan Software Autograph195BaruStatus usulan:0124128603UNIVERSITAS ALWASHLIYAH011017Penelitian Dosen PemulaKode:YUMIRA SIMAMORAPeningkatan Kemampuan Berpikir Kreatif dan Representative Matematis Siswa MA Melalui Pembelajaran Matematika Realistik196BaruStatus usulan:0111098601UNIVERSITAS ALWASHLIYAH011017Penelitian Dosen PemulaKode:LENI AGUSTINA DAULAYPeningkatan Kemampuan Penalaran dan Koneksi Matematika Siswa SMP dengan Menggunakan Pembelajaran Berbasis Masalah197BaruStatus usulan:0119088503UNIVERSITAS ALWASHLIYAH011017Penelitian Dosen PemulaKode:SYARIFAH FARISSI HAMAMA S.Si,. M.EdPENDAPAT SISWA TENTANG SIKAP GURU DAN PERILAKU SISWA TERHADAP MATA PELAJARAN BIOLOGI DI SMP NEGERI 1 DAN SMP NEGERI 6 BANDA ACEH198BaruStatus usulan:0121118404UNIVERSITAS ABULYATAMA011023Penelitian Dosen PemulaKode:SRI INDAH SETIYANINGSIHPENGARUH PENAMBAHAN TULANG IKAN LELE SEBAGAI SUMBER ZAT ADITIF ORGANIK TERHADAP KUAT TEKAN BETON199BaruStatus usulan:0008087801UNIVERSITAS MUHAMMADIYAH ACEH011024Penelitian Dosen PemulaKode:25




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAHMAD YUDHIRA S.E, Ak, M.SiPENERAPAN PERNYATAAN STANDAR AKUNTANSI PEMERINTAHAN NOMOR I TENTANG PENYAJIAN LAPORAN KEUANGAN PADA PEMERINTAHAN KOTA MEDAN224BaruStatus usulan:0021037606UNIVERSITAS CUT NYAK DHIEN011029Penelitian Dosen PemulaKode:AMIRUDIN S.EPengaruh Program Pemberian Kredit Terhadap Pertumbuhan Usaha Kecil Menengah di Kota Medan oleh PT. Bank Rakyat Indonesia Tbk (Persero) Medan Putri Hijau225BaruStatus usulan:0126068101UNIVERSITAS CUT NYAK DHIEN011029Penelitian Dosen PemulaKode:ABDUL CHALIK NASUTIONOptimalisasi Metode Electroplating Koagulasi Terhadap Penurunan Kadar Logam Zinkum (Zn) Pada Air Buangan Limbah Industri Pengolahan Karet226BaruStatus usulan:0127085301UNIVERSITAS CUT NYAK DHIEN011029Penelitian Dosen PemulaKode:TENGKU BOUMEDINE H ZULKIFLIKAJIAN VARIASI JARAK TANAM DAN DOSIS PUPUK DOLOMIT TERHADAP PERTUMBUHAN DAN PRODUKSI KACANG TANAH (Arachis hypogeae L.) DI LAHAN PASANG SURUT 227BaruStatus usulan:0026047204UNIVERSITAS CUT NYAK DHIEN011029Penelitian Dosen PemulaKode:MUKHLIS S.E.,M.SiHubungan Human Capital Dengan Kinerja Kader Pemberdayaan Masyarakat Desa (KPMD) Pada Program PNPM Mandiri Perdesaan Di Kecamatan Peusangan228BaruStatus usulan:0127077602UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:MUHAMMAD KHARIZMIKEEFEKTIFAN MODEL PEMBELAJARAN PLST (PILIH, LOMPAT, SAPU, TATAP) DALAM MENINGKATKAN KEMAMPUAN MEMBACA PEMAHAMAN MAHASISWASEMESTER IV PROGRAM STUDI PGSDUNIVERSITASALMUSLIM BIREUEN229BaruStatus usulan:0112078703UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:YAYUK KURNIA RISNAPemberian Tepung Kerang Hijau (Perna viridis) Dalam Ransum Terhadap Performans Ayam Broiler 230BaruStatus usulan:0109018701UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:NURMINAPengembangan Media Interaktif Komik Elektronik Berbasis Flash Movie Untuk meningkatkan Keterampilan Menulis Karya Sastra Mahasiswa Calon Guru Sekolah Dasar231BaruStatus usulan:0118038502UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:29

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI WAHYUNIPENGARUH PROGRAM SIMPAN PINJAM PEREMPUAN TERHADAP PERKEMBANGAN USAHA MIKRO KECIL KELOMPOK PEREMPUAN DI KECAMATAN DEWANTARA KABUPATEN ACEH UTARA232BaruStatus usulan:0126127602UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:AGUSNIREHABILITASI LAHAN KERING DENGAN OLAH TANAH DAN PEMBERIAN PUPUK KANDANG UNTUK PRODUKSI TANAMAN JAGUNG233BaruStatus usulan:0117088203UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:IQBAL M.CsSistem Pendukung Keputusan Penentuan Lokasi Penanaman Pohon Coklat Pada Kabupaten Bireuen234BaruStatus usulan:0124038403UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:MUHAMMAD IQBAL S.TH., M.Ag.IMPLEMENTASI BUDAYA SEKOLAH BERBASIS SYARIAT ISLAM PADA SEKOLAH MENENGAH ATAS DI KECAMATAN PEUSANGAN KABUPATEN BIREUEN235BaruStatus usulan:0117028002UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:ZARA YUNIZARSISTEM PAKAR DETEKSI PENYAKIT TANAMAN PADI MENGGUNAKAN CITRA 236BaruStatus usulan:0118108302UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:YESSI KARTIKAPeningkatan Kemampuan Berfikir Kreatif Matematis dan Hasil Belajar Siswa Melalui Pendekatan Open-Ended Berdasarkan Gender Siswa 237BaruStatus usulan:0120048301UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:YULIA SANTIPenerapan Permainan Lacak Kata Dengan Pendekatan Bermain Kreatif Untuk Meningkatkan Pemerolehan Bahasa Pada Anak Usia Dini ( Penelitian Kuasi Eksperimen Pada PAUD/TK Kecamatan Banda Sakti, Kota Lhokseumawe)238BaruStatus usulan:0114077801UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:AFIJALGROUP DECISION SUPPORT SYSTEM PENENTUAN LOKASI PENANAMAN CABAI MERAH239BaruStatus usulan:0125088401UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:30

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADENNY FIRMANSYAHMengembangkan Daya Saing Daerah yang Berbasis Perikanan di Kabupaten Bireuen Provinsi Aceh240BaruStatus usulan:0118098203UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:FAUZIATUL HALIMPengembangan Perilaku Sosio Emosional Pada Anak Usia Dini Dengan Membuat Dan Menggunakan Alat Permainan Edukatif (APE) (Penelitian Kuasi Eksperimen Pada PAUD/TK Kecamatan Jangka Kabupaten Bireuen)241BaruStatus usulan:0107118402UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:SARAH FAZILLAPENINGKATAN PEMAHAMAN KONSEP DAN KEMAMPUAN BERPIKIR KREATIF MAHASISWA CALON GURU SEKOLAH DASAR PADA KONSEP DASAR IPA MELALUI MODEL INQUIRY242BaruStatus usulan:0105108404UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:MAISURAAnalisis Kemampuan Guru Kelas 1 SD dalam Menerapkan Kurikulum Mata Pelajaran Pendidikan Jasmani Olah Raga dan Kesehatan 243BaruStatus usulan:0130038301UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:MUSRIZALEFESIENSI PENGEMBALIAN PINJAMAN PROGRAM SIMPAN PINJAM PEREMPUAN DALAM PENGENTASAN KEMISKINAN DI KECAMATAN DEWANTARA KABUPATEN ACEH UTARA DENGAN MENGGUNAKAN DATA ENVELOPMENT ANALYSIS ( DEA)244BaruStatus usulan:0128058204UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:TAUFIK JAHIDIN S.H., M.HDESAIN IDENTIFIKASI KAWASAN PERBATASAN DI PROVINSI ACEH YANG BERBASIS SEJARAH DAN PEMBANGUNAN BERKELANJUTAN SEBAGAI UJUNG TOMBAK DIPLOMASI DAN BENTENG KEUTUHAN NKRI245BaruStatus usulan:0103026902UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:ASRUL KARIMPengembangan Permainan Matematika untuk Meningkatkan Minat dan Hasil Belajar Mahasiswa Calon Guru SD246BaruStatus usulan:0101018604UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:ASRIDA S.E.,M.Si,AKANALISIS PERTANGGUNGJAWABAN KEUANGAN TERHADAP KINERJA PENYUSUNAN ANGGARAN PADA SATUAN KERJA PERANGKAT DAERAH(SKPD)DI KABUPATEN BIREUEN247BaruStatus usulan:0129056801UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:31

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARINDHIRA HUMAIRANI S.Pi, M.SiIsolasi dan Identifikasi Bakteri Berpotensi Patogen pada Ikan di Perairan Tambak Kecamatan Jangka Kabupaten Bireuen248BaruStatus usulan:0021107905UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:FACHRURAZIPenerapan Bahan Ajar Berbasis Number Sense Terhadap Kemampuan Pemecahan Masalah Pada Materi Operasi Hitung Bilangan Di Kelas V Sekolah Dasar249BaruStatus usulan:0103018701UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:ABDUL MALIK M.ScFRAKSINASI OLEIN DAN STEARIN MINYAK SAWIT KASAR (CPO) MENGGUNAKAN PELARUT ORGANIK250BaruStatus usulan:0130107204UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:ETY MUKHLESIYENIPENGGUNAAN KALKULATOR PADA MATAKULIAH MATEMATIKA DASAR UNTUK MENGEMBANGKAN KEMAMPUAN NUMBER SENSE MAHASISWA PGSD251BaruStatus usulan:0107108302UNIVERSITAS AL MUSLIM011032Penelitian Dosen PemulaKode:TIARNIDA NABABANHUBUNGAN PENERAPAN METODE ASUHAN KEPERAWATAN TIM DENGAN KEPUASAN KERJA PERAWAT DI INSTALASI RAWAT INAP RSUP HAJI ADAM MALIK MEDAN252BaruStatus usulan:0119057602UNIVERSITAS PRIMA INDONESIA011033Penelitian Dosen PemulaKode:NAMIRA UFRIDA RAHMIPENGARUH DEWAN KOMISARIS TERHADAP ENVIROMENTAL DISCLOUSURE PADA PERUSAHAAN PERTAMBANGAN YANG TERDAFTAR DI BURSA EFEK INDONESIA TAHUN 2009-2012253BaruStatus usulan:0128048303UNIVERSITAS PRIMA INDONESIA011033Penelitian Dosen PemulaKode:SE CUT FITRI ROSTINA M.MPERANAN KUALITAS PRODUK DAN HARGA DALAM MENDORONG MINAT BELI KONSUMEN LAPTOP MEREK ACER DI KOTA MEDAN254BaruStatus usulan:0118087303UNIVERSITAS PRIMA INDONESIA011033Penelitian Dosen PemulaKode:WIDYA SARIRendahnya Kualitas Layanan Operator Selular Dalam Pencapaian Tingkat Kepuasan Berkomunikasi Masyarakat di Kota Medan255BaruStatus usulan:0103048602UNIVERSITAS PRIMA INDONESIA011033Penelitian Dosen PemulaKode:32


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHURI AFRINA DEWIUJI COBA PEMBUATAN TEPUNG SAGU (Metroxylon sp.) DARI HASIL PASCA PANEN TRADISIONAL PETANI DI KABUPATEN NAGAN RAYA PROPINSI ACEH 264BaruStatus usulan:0117048501UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:DIAN ARIANIPENGUKURAN KINERJA EFISIENSI USAHA TANI PADI DI KABUPATEN NAGAN RAYA PROPINSI ACEH DENGAN PENDEKATAN DATA ENVELOPMENT ANALYSIS (DEA) 265BaruStatus usulan:0122028101UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:HEWI SUSANTIPERAN SEKTOR PERTANIAN DALAM MENGURANGI KETIMPANGAN PENDAPATAN DI PROPINSI ACEH 266BaruStatus usulan:0115048303UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:MUHAMMAD JALILIdentifikasi dan Eksplorasi Plasma Nutfah Padi Lokal di Kabupaten Nagan Raya Provinsi Aceh267BaruStatus usulan:0115068302UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:TRIYANTOAnalisis Perguliran Dana Simpan Pinjam Khusus Perempuan (SPP)PNPM Mandiri Perdesaan Terhadap Perkembangan UMKM: Studi Kasus Kecamatan Samatiga Kabupaten Aceh Barat Provinsi Aceh 268BaruStatus usulan:0115077102UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:ASTIAH AMIROPTIMASI BIAYA PELAKSANAAN KONSTRUKSI JALAN DENGAN APLIKASI REKAYASA NILAI (VALUE ENGINEERING)(Studi Kasus Project JNB1 Construction of Road Kabupaten Aceh Barat Provinsi Aceh)269BaruStatus usulan:0123037304UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:DARSONODINAMIKA DAN SUKSESI BAKTERI ASAM LAKTAT PADA FERMENTASI PLIEK U MAKANAN TRADISIONAL ACEH270BaruStatus usulan:0126016801UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:ARIE SAPUTRARancangan Model contract farming Untuk keberlanjutan Rantai Pasok Kopi Organik Gayo271BaruStatus usulan:0118048303UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:34

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJASMIIDENTIFIKASI KANDUNGAN GIZI DAN MUTU RASA PADI LOKAL VARIETAS SIGEUPAI272BaruStatus usulan:0127088002UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:NELINDAWillingness To Pay Masyarakat dan Kebutuhan Daya Tampung TPA Mata Ie Aceh Barat Pada Tahun 2020273BaruStatus usulan:0115038102UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:DEWI FITHRIAPeran Pemerintah dan Partisipasi Masyarakat Dalam Konservasi Wilayah Pesisir di Kabupaten Aceh Barat dan Kabupaten Aceh Jaya274BaruStatus usulan:0108117203UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:WINTAHStruktur Komunitas Makrozoobentos Sebagai Bioindikator Kerusakkan Mangrove pada Area Mangrove Pasca Tsunami275BaruStatus usulan:0117128202UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:SYURKARNI ALIKUAT TEKAN MATERIAL DARI BAHAN KOMPOSIT DIPERKUAT SERAT TANDAN KOSONG KELAPA SAWIT (TKKS)276BaruStatus usulan:0115127502UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:MITA SETYOWATIKajian Kadar NaCl dan Asam Oksalat Asam Sunti Pada Beberapa Pemberian Garam dan Cara Pengeringan277BaruStatus usulan:0122058001UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:MUHAMMAD ARRAFI S.KelAspek Biologi Ikan Layang (Decapterus spp.) Di Perairan Barat Aceh)278BaruStatus usulan:0126068605UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:KISWANTO M.SiPENGOLAHAN AIR GAMBUT DENGAN MENGGUNAKAN MEDIA MAGNET279BaruStatus usulan:0119107602UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:35

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARATIH MAYASARIAnalisis Zonasi Ekosistem Mangrove pada Kawasan Mangrove Bekas Tsunami di Aceh Barat Selatan280BaruStatus usulan:0108068302UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:KHAIRILSYAHPeran Gender Dalam Mengatasi Fenomena Kemiskinan Pada Rumah Tangga Relokasi Tsunami 2004 281BaruStatus usulan:0131106602UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:JOLI SUPARDIRANCANG BANGUN ALAT UJI IMPAK TIPE CHARPY (IMPACT TESTING MECHINE)282BaruStatus usulan:0112077801UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:NURLIANADVOKASI KEBIJAKAN TENTANG PENANGGULANGAN KEMISKINAN DI ACEH (STUDI KASUS KECAMATAN SAMATIGA KABUPATEN ACEH BARAT)283BaruStatus usulan:0124048202UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:ZAKIR HUSINPENGUKURAN LAJU KOROSI ATMOSFERIK PADA BAJA STRUKTURAL DIWILAYAH ACEH BARAT DAN NAGAN RAYA284BaruStatus usulan:0130017202UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:MEIDIA REFIYANNIPEMODELAN BANGKITAN PERJALANAN PADA DAERAH RELOKASI KORBAN GEMPA DAN TSUNAMI DI KABUPATEN ACEH BARAT285BaruStatus usulan:0107058102UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:FARAH DIANAModel Pengelolaan Sumberdaya Ikan Berbasis karakteristik Potensi Perairan Aceh Barat (Study Kasus : Hasil Tangkapan Per Unit Upaya (CPUE)Di Perairan Meulaboh)286BaruStatus usulan:0115098201UNIVERSITAS TEUKU UMAR MEULABOH011034Penelitian Dosen PemulaKode:TARULI ROHANA SINAGA SP, MKMPengaruh Pengetahuan Dan Sikap Terhadap Tindakan Ibu-Ibu Dalam Pola Makan Anak Autis Studi Pada Sekolah Luar Biasa Dan Institusi Terapi Autis Di Kota Binjai287BaruStatus usulan:0116107103Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:36

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADYNA GRACE ROMATUA ARUAN SST.,M.PdPENGARUH PENEBANGAN HUTAN MANGROVE TERHADAP INTRUSI AIR LAUT PADA AIR SUMUR GALI PENDUDUK DI KECAMATAN PERCUT SEI TUAN 288BaruStatus usulan:0109128001Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:SERI ASNAWATI MUNTHE,SKM,M.KES SKM, PENGARUH PEMAKAIAN KELAMBU DAN LINGKUNGAN RUMAH TERHADAP KEJADIAN MALARIA DI WILAYAH KERJA PUSKESMAS BESITANG KABUPATEN LANGKAT TAHUN 2013289BaruStatus usulan:0127027101Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:SETIA MENDA BR GINTING SPd, MSiPengaruh Budaya Memakan Sirih Bagi Perempuan Suku Karo Terhadap Komunikasi Interpersonal dengan Suami Dalam Keluarga Di Kabanjahe Kabupaten Karo290BaruStatus usulan:0110085601Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:AMILAAnalisis Faktor - Faktor Risiko Nyeri Punggung Bawah Pada Perawat Di Ruang IGD dan ICU Rumah Sakit Umum Sari Mutiara Medan291BaruStatus usulan:0221017602Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:ITINGMANAJEMEN MALNUTRISI DENGAN MODEL MINI NUTRITIONAL ASSESMENT (MNA) DAN BARTHEL INDEX PADA PASIEN STROKE DI RUANG NEUROLOGI RUMAH SAKIT UMUM PIRNGADI MEDAN292BaruStatus usulan:0427097202Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:NOVA FLORENTINA AMBARWATI S.ST.,M.Pd.ANALISIS FAKTOR RISIKO KERACUNAN PESTISIDA ORGANOFOSFAT PADA PETANI SAWI PUTIH DI DESA SIMPANG RAJA PAYUNG KECAMATAN MERDEKA KABUPATEN KARO293BaruStatus usulan:0120068201Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:EVARINA SEMBIRING SST, M.KesAnalisis Faktor Determinan Terhadap Densitas Tulang Sekunder Osteoporosis Pada Lanjut Usia Di Tiga Panti Werdha Kota Medan294BaruStatus usulan:0130096301Universitas Sari Mutiara Indonesia Medan011045Penelitian Dosen PemulaKode:HIBNUL WALID ST, MTAnalisa Pengaruh Pasar Retail Modern Terhadap Pasar Tradisional dan UMKM (Usaha Mikro, Kecil, Menengah) di Kota Medan295BaruStatus usulan:0117055901INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:37

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANYIMAS YANQORITHA S.Si.,M.ScOptimasi Aktivator Trichoderma harzianum dengan Trichoderma reseii Dalam Pembuatan Kompos Organik Dari Limbah Sayur Pasar296BaruStatus usulan:0101016911INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:JUFRIZAL STUJI KEMAMPUAN THERMAL ENERGY STORAGE BERBENTUK TABUNG SILINDER YANG TERINTEGRASI DALAM KOLEKTOR SURYA297BaruStatus usulan:0119028202INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:HERLINA S.Si., M.SiPembuatan dan Karakterisasi Elektroda Selektif Ion La (III) dengan Membran Cair Berpendukung PTFE dan H2DdBP sebagai Ionofor298BaruStatus usulan:0009027604INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:EDDY SUTEJOPENGARUH VARIASI PERLAKUAN PANAS DAN AGING PADA CENTRIFUGAL CASTING 400 rpm DENGAN GRAIN REFINER Al-TiB 7,5 % TERHADAP SIFAT FISIS DAN MEKANS PADUAN ALUMINIUM COR A356 VELG SEPEDA MOTOR 299BaruStatus usulan:0121106901INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:Ir. HUSNY M.SiEvaluasi Kinerja Perlintasan Sebidang Di Ruas Jalan Sisingamangaraja Medan300BaruStatus usulan:0007095602INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:ERNI YUSNITA S.T,M.T.Pengukuran Tingkat Kepuasan Mahasiswa Terhadap Kualitas Pelayanan Pendidikan Di Institut Teknologi Medan301BaruStatus usulan:0120057302INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:LISMAWATY S.T., M.T.ANALISA INDIKASI SINTERING TERHADAPPEMBESARAN BUTIRAN PRODUK ROD MILLAKIBAT PERTAMBAHAN WAKTU GILING302BaruStatus usulan:0102127002INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:SUSRI MIZHAR ST, MTKajian Pengaruh Variasi Konsentrasi Media Pendingin (quenchant) pada Proses Quench Terhadap Kekerasan , Struktur Mikro dan Retak Akibat Quench (Quench Crack) dari Baja AISI 4140303BaruStatus usulan:0115037603INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:38

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMEYGA FITRI HANDAYANI NASUTION ST,MTPelestarian Kawasan Kota Tanjung Pura sebagai Aset Wisata di Kabupaten Langkat304BaruStatus usulan:0112057202INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:TRI HADI JATMIKO ST. MTPEMODELAN REAKTOR UNGGUN TETAP UNTUK REAKSI GAS TO LIQUID PADA PROSES PENCAIRAN GAS ALAM305BaruStatus usulan:0114088002INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:MAHYUNIS STPEMBUATAN DAN PENYELIDIKAN PERILAKU MEKANIK KOMPOSIT POLYMERIC FOAM DIPERKUAT SERAT TANDAN KOSONG KELAPA SAWIT AKIBAT BEBAN IMPAK306BaruStatus usulan:0114128202INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:DERLINI S.T.,M.T.Rancangan Alat Pengepres Emping Melinjo Menggunakan Quality Function Deployment307BaruStatus usulan:0127097302INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:TONY SIAGIAN STPenyelidikan sifat serap Komposit yang terbuat dari bahan Polyester dengan Pengisi serat Rockwool secara Simulasi. 308BaruStatus usulan:0103127503INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:Drs. M. KAMIL ST, MTDesain dan pembuatan body mobil urban concept dari bahan komposit diperkuat serat kaca.309BaruStatus usulan:0116016104INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:MERI SRI WAHYUNIRekayasa Perancangan Sistem pakar untuk mendeteksipenyakit akibat protozoa dengan metode certainty factor310BaruStatus usulan:1005067901INSTITUT TEKNOLOGI MEDAN012003Penelitian Dosen PemulaKode:SARAH IMELDA SE., M.Si.PENGARUH KECERDASAN EMOSIONAL DAN STRES KERJA TERHADAP KINERJA KARYAWAN DENGAN KOMITMEN ORGANISASI SEBAGAI VARIABEL INTERVENING PADA PT. PP. LONDON SUMATRA INDONESIA TBK KEBUN BAH LIAS RESEARCH STATION SIMALUNGUN311BaruStatus usulan:0126058401SEKOLAH TINGGI ILMU EKONOMI HARAPAN013009Penelitian Dosen PemulaKode:39


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMALIZA NOVIETTA SE., M.Si. Ak.IMPLIKASI RASIO-RASIO KEUANGAN TERHADAP TINGKAT LABA PERUSAHAAN MANUFAKTUR DENGAN UKURAN PERUSAHAAN SEBAGAI VARIABEL PEMODERASI320BaruStatus usulan:0013117703SEKOLAH TINGGI ILMU EKONOMI HARAPAN013009Penelitian Dosen PemulaKode:ILHAM MUBARAQ RITONGA SE.KAJIAN BENTUK GAYA KEPEMIMPINAN YANG MEMBANGUN KEPUASAN KERJA DAN DAMPAKNYA TERHADAP KOMITMEN ORGANISASI (STUDI PADA PTS KOPERTIS WILAYAH I)321BaruStatus usulan:0124098102SEKOLAH TINGGI ILMU EKONOMI HARAPAN013009Penelitian Dosen PemulaKode:AHMAD BIMA NUSAEVALUASI BIAYA KONSTRUKSI DAN KUAT TEKAN BETON DENGAN MENGGUNAKAN BETON DAUR ULANG PADA PROYEK SEDERHANA DI KOTA MEDAN322BaruStatus usulan:0120087104SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:Dra HERLINA HARAHAP M.SiSistem Penjadwalan Matakuliah Praktikum Untuk Kelas PeminatanMenggunakan Algoritma Genetika (Studi Kasus: Pada Puskom STTH Medan) 323BaruStatus usulan:0111056401SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:UMMULKHAIRRobot Cerdas Pengangkut BAk Sampah Organik dan Anorganik Menggunakan Sensor Warna TSC3200324BaruStatus usulan:0115047601SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:BUDHI SANTRI KUSUMAAnalisa Pengaruh Pemanasan dan MEdia Pendingin Terhadap Struktur Mikro dan Kekerasan Pada Proses Tempering Baja Perkakas SKD 11325BaruStatus usulan:0106016904SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:HUSNI ILYASSistem Pengamanan Jarak Jauh Berbasis Jaringan Untuk Realisasi Rumah Cerdas326BaruStatus usulan:0123027201SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:YUSSA ANANDAPengenalan Plat Nomor Kendaraan Bermotor Menggunakan Algoritma Gabor Dan Jaringan Syaraf Tiruan Back Propagation Pada Citra Untuk Sistem Perparkiran Mall (Studi Kasus Kota Medan)327BaruStatus usulan:0115126301SEKOLAH TINGGI TEKNOLOGI HARAPAN013011Penelitian Dosen PemulaKode:41



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANDRIASAN SUDARSOPengaruh Corporate Image Dan Kualitas Pelayanan Terhadap Customer Value Dan Loyalitas Pelanggan Hotel Grand Aston City Hall Medan344BaruStatus usulan:0121116801SEKOLAH TINGGI ILMU EKONOMI IBBI013074Penelitian Dosen PemulaKode:HALIM LOLY SE., MM.Pengukuran Indeks Kepuasan Masyarakat Terhadap Pelayanan Kantor Pelayanan Pajak Pratama Medan Kota345BaruStatus usulan:0120098302SEKOLAH TINGGI ILMU EKONOMI IBBI013074Penelitian Dosen PemulaKode:RAHMAT HIDAYAT SEModel Pengukuran Kepuasan Kerja Karyawan berbasis Performance Appraisal (Studi Kasus pada Perusahaan BUMN di Kota Medan)346BaruStatus usulan:0102017701SEKOLAH TINGGI ILMU MANAJEMEN SUKMA013085Penelitian Dosen PemulaKode:LINDA HERNIKE NAPITUPULU S.KM., M.KesAnalisis zat pewarna rhodamin B pada cabai merah giling yang dipasarkan dibeberapa pasar kota medan sumatera utara347BaruStatus usulan:0122087602SEKOLAH TINGGI ILMU KESEHATAN HELVETIA013101Penelitian Dosen PemulaKode:VIVI EULIS DIANA S.Si, MEM, AptUJI EKSTRAK DAUN SENDOK (Plantago mayorL.) UNTUK MENGONTROL KADAR GULA DARAH348BaruStatus usulan:0122116402SEKOLAH TINGGI ILMU KESEHATAN HELVETIA013101Penelitian Dosen PemulaKode:Ir NENI EKOWATI JANUARIANA M.PhANALISIS PENYEBAB DIARE PADA BALITA DI PUSKESMAS BANDAR SENEMBAH KECAMATAN BINJAI BARATKOTAMADYA BINJAI349BaruStatus usulan:0116016401SEKOLAH TINGGI ILMU KESEHATAN HELVETIA013101Penelitian Dosen PemulaKode:DARWIN SYAMSUL S.Si.,M.Si.,AptFORMULASI SEDIAAN SALEP EKSTRAK ETANOL DAUN SIRSAK (Annonae muricatae Folium) UNTUK PENYEMBUHAN PADA LUKA GORES350BaruStatus usulan:0125096601SEKOLAH TINGGI ILMU KESEHATAN HELVETIA013101Penelitian Dosen PemulaKode:HARTONO S.Kom, M.KomRancangan Sistem Pembelajaran Pengenalan Bentuk Benda DalamBahasa Inggris Berbasis Multimedia di Sekolah Taman Kanak-Kanak St.Ignatius Medan351BaruStatus usulan:0107098601STMIK IBBI013115Penelitian Dosen PemulaKode:44



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMESTIANA BR KARO S.Kep., Ns., M.KepPENGARUH PEER GROUP SUPPORT TERHADAP PENINGKATAN KONSEP DIRI PADA PENDERITA KUSTA DI PANTI KUSTA GEMA KASIH GALANG368BaruStatus usulan:0117127302STIKES SANTA ELISABETH MEDAN013140Penelitian Dosen PemulaKode:MARSONO S.Kom., M.KomPERANCANGAN PERANGKAT E-VOTING UNTUK PEMILU, PILPRES DAN PILKADA DENGAN MENGGUNAKAN E-KTP369BaruStatus usulan:0102057501STMIK Triguna Dharma013157Penelitian Dosen PemulaKode:PURWADIAPLIKASI KRIPTOGRAFI ASIMETRIS DENGAN METODE DIFFIE-HELLMAN DAN ALGORITMA ELGAMAL UNTUK KEAMANAN TEKS370BaruStatus usulan:0104038004STMIK Triguna Dharma013157Penelitian Dosen PemulaKode:SULINDAWATY S.KOM, M.KOMPENDISTRIBUSIAN BARANG FARMASI MENGGUNAKAN ALGORITMA DIJKSTRA STUDI KASUS : PT. AIR MAS CHEMICAL371BaruStatus usulan:0107048201STMIK Triguna Dharma013157Penelitian Dosen PemulaKode:MUHAMMAD DAHRIA S.E., S.KOM., M.KOMAnalisis Web Server Log Dalam Pencarian Pola Pengunjung Web Dengan Teknik Association Rules372BaruStatus usulan:0107117201STMIK Triguna Dharma013157Penelitian Dosen PemulaKode:ISHAK S.Kom., M.KomAplikasi Sistem Pakar Memprediksi Kualitas Kain Batik373BaruStatus usulan:0120026903STMIK Triguna Dharma013157Penelitian Dosen PemulaKode:NURUL HUSNAPERBANDINGAN PRESTASI BELAJAR SISWA KELAS AKSELERASI DENGAN KELAS REGULER DI SMA NEGERI 3 BANDA ACEH374BaruStatus usulan:0112067802STKIP Bina Bangsa Meulaboh013169Penelitian Dosen PemulaKode:RITA OKTAVIA M.SiDIVERSITAS UDANG AIR TAWAR DI ACEH BARAT PROVINSI ACEH375BaruStatus usulan:0127108701STKIP Bina Bangsa Meulaboh013169Penelitian Dosen PemulaKode:47

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFITRIATI M.EdMeningkatkan Mutu Pendidikan Matematika Melalui Pengembangan Pendekatan Rich Tasks Serta Pengaruhnya Terhadap Peningkatan Kemampuan Koneksi Dan Berfikir Reflektif Matematis Siswa376BaruStatus usulan:0101018304STKIP Bina Bangsa Meulaboh013169Penelitian Dosen PemulaKode:KHAUSARPemetaan Potensi Sekolah Inklusif Berbasis Welcoming Schools Untuk Anak Berkebutuhan Khusus Di SDN Luar Biasa Kabupaten Aceh Barat Daya 377BaruStatus usulan:0101068404STKIP Bina Bangsa Meulaboh013169Penelitian Dosen PemulaKode:ZAINAL ABIDIN SUARJAMANAJEMEN BERBASIS SEKOLAH DALAM PENGELOLAAN PEMBIAYAAN SEKOLAH DI SD NEGERI KOTA BANDA ACEH378BaruStatus usulan:0114058503STKIP Bina Bangsa Meulaboh013169Penelitian Dosen PemulaKode:SARIADIN SIALLAGAN S.T., M.Cs.Sistem Kripto Kunci Asimetrik Menggunakan Elliptic Curve Cryptography Point Compression Terhadap Citra Digital Pada Jurusan Manajemen Informatika AMIK MBP Medan379BaruStatus usulan:0124047001AMIK MEDAN BUSINESS POLYTEKNIK014036Penelitian Dosen PemulaKode:JAIDUP BANJARNAHORPerancangan Data Warehouse Pendidikan Pada AMIK Medan Business Polyteknik Medan380BaruStatus usulan:0130037201AMIK MEDAN BUSINESS POLYTEKNIK014036Penelitian Dosen PemulaKode:DICKY APDILAH ST, M.KomAnalisa Pengaruh Gesekan Pembebanan Terhadap Performa Putaran dan Kecepatan Motor 1 Phasa 60 W Dengan Aplikasi Pendeteksi Kerusakan Yang Menggunakan Methode Fuzzy Logic Pada Mesin Peruncing 381BaruStatus usulan:0114048302AMIK INTELCOM GLOBAL INDO KISARAN014121Penelitian Dosen PemulaKode:SITI RAHMA YUNI SE,MMANALISIS LAPORAN KEUANGAN DALAM PENINGKATAN PENDAPATAN 382BaruStatus usulan:0117068102AMIK INTELCOM GLOBAL INDO KISARAN014121Penelitian Dosen PemulaKode:DENI P LUMBANTORUANRancang Bangun Prototype Meteran Listrik Prabayar383BaruStatus usulan:0114017901POLITEKNIK INFORMATIKA DEL TOBA SAMOSIR015002Penelitian Dosen PemulaKode:48

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAALBERT SAGALA M.TMonitoring Kompetisi Pertahanan Cyber384BaruStatus usulan:0104027801POLITEKNIK INFORMATIKA DEL TOBA SAMOSIR015002Penelitian Dosen PemulaKode:RAMEN A PURBA S.Kom., M.KomSISTEM INFORMASI GEOGRAFIS UNTUK PEMETAAN LOKASI PENGUNGSIAN PADA KABUPATEN KARO BERBASIS WEB385BaruStatus usulan:0110118103POLITEKNIK UNGGUL LP3M015003Penelitian Dosen PemulaKode:HAMDI S.E., M.SiANALISIS DETERMINAN INVESTASI SEKTOR PERTANIAN DI INDONESIA 386BaruStatus usulan:0114088402POLITEKNIK UNGGUL LP3M015003Penelitian Dosen PemulaKode:LAMHOTANALISIS VARIABEL-VARIABEL YANG MEMPENGARUHI DIVIDEND PAYOUT RATIO PADA PERUSAHAAN YANG GO PUBLIC DI INDONESIA387BaruStatus usulan:0121086902POLITEKNIK MANDIRI BINA PRESTASI015005Penelitian Dosen PemulaKode:MAULIDINAAplikasi Quality Function Deployment (QFD) Untuk Meningkatkan Mutu Pelayanan Jasa Bank Syariah (Studi Kasus: Bank Syariah Mandiri Medan Simpang Limun, Bank Syariah Mandiri Medan Gajah Mada, Bank Syariah Mandiri Medan Petisah)388BaruStatus usulan:0108047402POLITEKNIK LP3I MEDAN015009Penelitian Dosen PemulaKode:S.SI IRWANTOHUBUNGAN PREFERENSI GAYA BELAJAR VISUAL, AUDITORI DAN KINESTETIKDENGAN PRESTASI MAHASISWA PROGRAM STUDIADMINISTRASI BISNIS POLITEKNIK LP3I MEDAN389BaruStatus usulan:0315087104POLITEKNIK LP3I MEDAN015009Penelitian Dosen PemulaKode:INDRA HERMAWANKajian Potensi Energi Panas Buangan Dari Air Conditioner (AC)390BaruStatus usulan:0114048001POLITEKNIK LP3I MEDAN015009Penelitian Dosen PemulaKode:ISWANDI IDRISANALISIS PERANCANGAN SISTEM INFORMASI TERINTEGRASI (SIT)DI LINGKUNGAN PERGURUAN TINGGI SWASTA (PTS) DI MEDAN391BaruStatus usulan:0126067603POLITEKNIK LP3I MEDAN015009Penelitian Dosen PemulaKode:49

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAGNITA YOLANDA B.COMM, M.SCEfektivitas Penggunaan Komunikasi Non Verbal Pada Bank Syariah (Studi Kasus: Bank Syariah Mandiri dan Bank Muamalat Medan, Stabat dan Binjai)392BaruStatus usulan:0114018601POLITEKNIK LP3I MEDAN015009Penelitian Dosen PemulaKode:LENNARIA L TARIGANPembentukan Loyalitas Pelanggan Melalui Kualitas Layanan dan Kepuasan Pelanggan (Studi Kasus Indomaret Simpang Santhomas)393BaruStatus usulan:0118097402POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:JONNER MANIHURUKRancang Bangun Cos-phi meter Digital dengan Turbo Pascal394BaruStatus usulan:0122047302POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:MEGARIA PURBA S. Si., S. Pd., M. KPenerapan Metode E-learning Pada Bidang studi Matematika SMP RK Bunda Mulia Saribudolok395BaruStatus usulan:0118047001POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:- SAUT MATEDIUS SITUMORANG S.TPerancangan Sistem Kendali Otomatis Debit Air Dalam Tedmond dan Water Treatment pada Mesin Boiler Menggunakan Programmable Logic Controller (PLC)396BaruStatus usulan:0128027902POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:BANGUN SIHOTANGPerancangan Trainer Ripple Mill Pemecah Biji Kelapa Sawit397BaruStatus usulan:0128107703POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:DAMERIA ESTERLINA BR JABAT S.Kom.,M.KomSistem Pendukung Keputusan Menggunakan Metode Analytical Hierarchy Process (AHP)(Studi Kasus Penentuan Penerima Beasiswa Pada Politomas) 398BaruStatus usulan:0124097401POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:FRANSITO SIMBOLONPenelitian eksperimen pemanas air tenaga surya sistim pipa panas dengan R410a399BaruStatus usulan:0127027901POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:50

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADra. YUSTINA EVELINA DERITA R M.M.PENGARUH PEMBELAJARAN MATEMATIKA TERHADAP HASIL BELAJAR PEMROGRAMAN VISUAL BASIC PADA PROGRAM STUDI MANAJEMEN INFORMATIKA POLITEKNIK SANTO THOMAS 400BaruStatus usulan:0126106601POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:S.T., M.T. ANTONIUS MANAGAM SIMAMORA -RANCANG BANGUN SOLAR TRACKING SYSTEM UNTUK MENGOPTIMALKAN PENYERAPAN ENERGI MATAHARI PADA SOLAR CELL BERBASIS MIKROKONTROLER AT89S51401BaruStatus usulan:0124126701POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:Drs HENDRICUS MARBUN M. Pd.Perancangan Software Sistem Pencarian Kerusakan Sepeda Motor Berteknologi Electronic Fuel Injection (EFI)402BaruStatus usulan:0113085701POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:GALIH PRIBADIRancang Bangun Miniatur Conveyer Belt Cerdas Berbasis Mikrokontroler AT89S51403BaruStatus usulan:0125108701POLITEKNIK SANTO THOMAS015011Penelitian Dosen PemulaKode:DIDIEK HARI NUGROHO STPENGARUH DESAIN NOZZLE TERHADAP KINERJA ABSORPSI KOLOM GELEMBUNG PANCARAN (JET BUBBLE COLUMN)404BaruStatus usulan:0130108001Politeknik Aceh015014Penelitian Dosen PemulaKode:MUHAMMAD AGIL HAIKAL STSISTEM PENGONTROLAN DAN MONITORING LEVEL TEGANGAN PLC SECARA WIRELESS BERBASIS EMBEDDED LINUX405BaruStatus usulan:0116048602Politeknik Aceh015014Penelitian Dosen PemulaKode:SAFWAN STAnalisis Pengaruh delay dan Troughput terhadap performansi layanan Sistem Informasi Politeknik Aceh berdasarkan jaringan kabel dan wireless406BaruStatus usulan:0119038303Politeknik Aceh015014Penelitian Dosen PemulaKode:BUDIANTO SEFaktor-faktor yang mempengaruhi pelaporan keuangan melalui internet (internet financial reporting) pada perusahaan manufaktur yang terdaftar di BEI407BaruStatus usulan:0130128301Politeknik Aceh015014Penelitian Dosen PemulaKode:51

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAINDRAYANIANALISIS PERBANDINGAN PROFITABILITAS PERUSAHAAN SEBELUM DAN SESUDAH PENGUNGKAPAN CORPORATE SOCIAL RESPONSIBILITY (STUDI EMPIRIS PADA PERUSAHAAN MANUFAKTUR DI BURSA EFEK INDONESIA).408BaruStatus usulan:0115078703Politeknik Aceh015014Penelitian Dosen PemulaKode:EFFENDI STPERANCANGAN INVERTER SATU FASA PADA SISTEM SEL SURYA UNTUK APLIKASI PENERANGAN PENDESAAN409BaruStatus usulan:0125097703Politeknik Aceh015014Penelitian Dosen PemulaKode:ABRAR AMRI SEPENGARUH INTELLECTUAL CAPITAL, ORGANIZATIONAL LEARNING DAN INFORMATION TECHNOLOGY CAPABILITY TERHADAP KINERJA BUMN DI KOTA BANDA ACEH 410BaruStatus usulan:0122078601Politeknik Aceh015014Penelitian Dosen PemulaKode:RISMADI SEPenilaian Kinerja Dengan Pendekatan Balanced Scorecard Pada Kantor Walikota Banda Aceh411BaruStatus usulan:0114038304Politeknik Aceh015014Penelitian Dosen PemulaKode:ILHAM HASBIULLAH STAnalisis Relative Humidity pada ruang pengering surya menggunakan metode Regresi Polynomial Orde 2 dan Program aplikasi Microsoft Visual Basic 6412BaruStatus usulan:0117078402Politeknik Aceh015014Penelitian Dosen PemulaKode:BUDI AMRI STPEMBUATAN SISTEM PENGONTROLAN SUHU HEATER DAN TIMER UNTUK MENGOPTIMALKAN FUNGSI RICE COOKER SEBAGAI ALAT MEMASAK.413BaruStatus usulan:0131018103Politeknik Aceh015014Penelitian Dosen PemulaKode:ANDIKA VEBRINA STSISTEM PAKAR DIAGNOSA GEJALA TANDA BAHAYA KEHAMILAN BERBASIS ANDROID MOBILE414BaruStatus usulan:0110028601Politeknik Aceh015014Penelitian Dosen PemulaKode:DIEN TAUFAN LESSY S.STAplikasi Penelusuran Rute (Tracert) Lokasi pada Peta Digital Banda Aceh Berbasis Android415BaruStatus usulan:0110018402Politeknik Aceh015014Penelitian Dosen PemulaKode:52

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFAJAR ARY PRABOWO S.STRancang Bangun sistem pendukung keputusan untuk penjurusan siswa SLTA berdasarkan multiple intellegency menggunakan jaringan syaraf tiruan backpropagation416BaruStatus usulan:0112098501Politeknik Aceh015014Penelitian Dosen PemulaKode:RAHMAD SADLI STSISTEM PENGONTROLAN PERALATAN LISTRIK BERBASIS MIKROKONTROLER ATMEGA32 DAN PLATFORM ANDROID417BaruStatus usulan:0124048104Politeknik Aceh015014Penelitian Dosen PemulaKode:DONI KASMON K A.MdAnalisis Perbedaan Harga Saham, Volatilitas Harga Saham, Dan Aktivitas Volume Perdagangan Saham Sebelum dan Sesudah Peristiwa Pengumuman Stock Split di Bursa Efek Indonesia Tahun 2003-2012418BaruStatus usulan:0106078004Politeknik Aceh015014Penelitian Dosen PemulaKode:RIZKI FAULIANUR A.MdPengembangan modul praktik PID kontrol untuk mengatur kecepatan motor DC pada laboratorium Sistem Kendali Politeknik Aceh419BaruStatus usulan:0119018801Politeknik Aceh015014Penelitian Dosen PemulaKode:ZOEL FACHRI S.STPERENCANAAN ALAT IBS (INTERLOCKING BRIKCS SYSTEM) DENGAN SISTEM HIDROLIK TERKONTROL420BaruStatus usulan:0104098502Politeknik Aceh015014Penelitian Dosen PemulaKode:ZAKWANSYAH STTEKNOLOGI PENYIRAMAN OTOMATIS UNTUK MENINGKATKAN EFISIENSI DAN PEMERATAAN PENYIRAMAN PADA PROSES PEMBIBITAN JABON ACEH MENGGUNAKAN PLC DENGAN METODE HOLLOW PIPE HORIZONTAL421BaruStatus usulan:0104097702Politeknik Aceh015014Penelitian Dosen PemulaKode:SYOFYAN ANWARSYAH PUTRAAnalisa Penggunaan Filter Pasif Single Tuned Untuk Mereduksi Harmonisa Pada Personal Computer (PC)422BaruStatus usulan:0121038002Politeknik Tanjungbalai015015Penelitian Dosen PemulaKode:MUSTAKIM ST.,M.EngPengaruh Reynold Number Terhadap Head Losses Pada Variasi Jenis Belokan Pipa423BaruStatus usulan:0117088501Politeknik Tanjungbalai015015Penelitian Dosen PemulaKode:53

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMALUCIA DEWI INDRAYANI MANURUNGPenggunaan Jenis Kerang yang Berbeda Pada Pengolahan Keripik Kerang Terhadap Penerimaan Konsumen424BaruStatus usulan:0112028303Politeknik Tanjungbalai015015Penelitian Dosen PemulaKode:SUHERMAN ST. MTPengaruh penambahan sodium terhadap sifat mekanis dan struktur mikro paduan A356 pada proses pembuatan prototipe Head cylinder motor 2 tak dengan metode pengecoran evaporative425BaruStatus usulan:0109077902Politeknik Tanjungbalai015015Penelitian Dosen PemulaKode:WELLY SE.,M.Si.Perilaku Belajar Mahasiswa Akuntansi Terhadap Prestasi Akademik Di Perguruan Tinggi Swasta Kota Palembang426BaruStatus usulan:0212128102UNIVERSITAS MUHAMMADIYAH PALEMBANG021001Penelitian Dosen PemulaKode:DEDY SUBANDOWOSTRATEGI KESOPANAN BERBAHASA TERHADAP KEMAMPUAN TINDAK TUTUR MAHASISWA PRODI PENDIDIKAN BAHASA INGGRIS UNIVERSITAS MUHAMMADIYAH METRO427BaruStatus usulan:0215068603UNIVERSITAS MUHAMMADIYAH METRO021004Penelitian Dosen PemulaKode:SUDARMAJI M.Mkom.MANFAAT PENGOLAHAN DATA SISTEM INFORMASI MANAJEMEN SEBAGAI SARANA SOSIALISASI PASAR TRADISIONAL SECARA ONLINE KEPADA MASYARAKAT KOTA METRO428BaruStatus usulan:0201067402UNIVERSITAS MUHAMMADIYAH METRO021004Penelitian Dosen PemulaKode:AMIRUDIN LATIFPENGEMBANGAN MATERI READING II YANG TERINTEGRASI DENGAN AL-ISLAM DAN KEMUHAMMADIYAHAN429BaruStatus usulan:0203038002UNIVERSITAS MUHAMMADIYAH METRO021004Penelitian Dosen PemulaKode:PRIMA ANGKUPI M.H.PENGARUH WARNET (WARUNG INTERNET) TERHADAP FAKTOR SEKUNDER PENINGKATAN KONSUMSI PORNOGRAFI MELALUI MEDIA INTERNET DI KOTA METRO430BaruStatus usulan:0223128601UNIVERSITAS MUHAMMADIYAH METRO021004Penelitian Dosen PemulaKode:SUHARNO ZENINVENTARISASI TANAMAN YANG BERPOTENSI SEBAGAI BIOINSEKTISIDA NYAMUK Aedes aegyptii DI KOTA METRO PROPINSI LAMPUNG431BaruStatus usulan:0223028204UNIVERSITAS MUHAMMADIYAH METRO021004Penelitian Dosen PemulaKode:54



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATITI DARMIOptimalisasi Pelayanan Publik Berbasis Implementasi Kebijakan dan Budaya Organisasi di Kota Bengkulu448BaruStatus usulan:0218096801UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:THANSIFaktor-faktor yang mempengaruhi pengambilan keputusan kredit modal kerja pada beberapa Bank dikota Bengkulu449BaruStatus usulan:0205116801UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:HARRY WITRIYONOTeknik Penanganan Data Bertipe Binnary Large Object Pada Pengembangan Sistem Informasi Kepegawaian Universitas Muhammadiyah Bengkulu450BaruStatus usulan:0210126903UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:AFRIYANTO SP, M.KesIDENTIFIKASI ADANYA KANDUNGAN PARACETAMOL PADA JAMU PEGAL LINU DAN JAMU GENDONG DI PASAR TRADISIONAL KOTA BENGKULU451BaruStatus usulan:0213047302UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:YULIA DARMI S.Kom, M.KomDesain dan Implementasi e-Skripsi Pada Fakultas Teknik Universitas Muhammadiyah Bengkulu Menggunakan Metode Find452BaruStatus usulan:0210067002UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:DEDY ABDULLAHKOMPARASI METODE OTSU DENGAN METODE FUZZYC-MEANS PADA HASIL SEGMENTASI IDENTIFIKASIKARAKTER PLAT NOMOR KENDARAAN INDONESIA453BaruStatus usulan:0210128103UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:BETRIANITA S.Km., M.Km.ANALISIS PERILAKU SEKSUAL REMAJA DAN STIGMA MASYARAKAT TENTANG PERILAKU SEKSUAL REMAJA DI KECAMATAN LUBUK SANDI KABUPATEN SELUMA PROVINSI BENGKULU TAHUN 2014454BaruStatus usulan:0211098101UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:IPRIANTOPengaruh Ketidaktepatan Penyampaian Surat Pemberitahuan (SPT)-Masa Terhadap Penerimaan Pajak Penghasilan (PPh) Pasal 21 Pada Kantor Pelayanan Pajak (KPP) Bengkulu (Survei Pada Wajib Pajak di Kecamatan Sungai Serut Kota Bengkulu).455BaruStatus usulan:0213067601UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:57

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAETI ARINI SE., MM.ANALISIS STRATEGI PENCIPTAAN WIRAUSAHA DAN STRATEGI PENDUKUNG TERHADAP PERKEMBANGAN USAHA KECIL MENENGAH YANG TERDAFTAR PADA KANTOR KOPERASI DAN (UKM) YANG ADA DI KOTA BENGKULU456BaruStatus usulan:0227086601UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:DEDY AGUNG PRABOWO S.Kom, M.KomSistem Informasi Pendataan Mahasiswa Menggunakan Fitur Binary Large Object (BLOB) untuk Menyimpan Data Gambar Studi Kasus Pada Program Studi Sistem Informasi Universitas Muhammadiyah Bengkulu457BaruStatus usulan:0231108502UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:FITHRI MUFRIANTIEANALISIS PRODUKSI DAN EFISIENSI ALOKATIF USAHATANI BAYAM (Amarathus sp)DI KOTA BENGKULU458BaruStatus usulan:0222077605UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:Drs ENDANG SULAIMAN M.PdPENERAPAN LESSON STUDY MELALUI MODEL PROBLEM BASED LEARNING PADA MATA KULIAH SISTEMATIKA HEWAN VERTEBRATA DI PROGRAM STUDI PENDIDIKAN BIOLOGI UNIVERSITAS MUHAMMADIYAH BENGKULU459BaruStatus usulan:0021086801UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:ISLAMUDDIN SE., MM.PROGRAM KEMITRAAN DAN BINA LINGKUNGAN DAN PENGARUHNYA TERHADAP PENGEMBANGAN UKM DI KOTA BENGKULU( STUDI KASUS PT. JASA RAHARJA (PERSERO) CABANG BENGKULU)460BaruStatus usulan:0201026802UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:YUSMANIARTIPengaruh Penyajian Informasi Akuntansi Pemerinta Daerah Terhadap Transparansi dan Akuntabilitas Publik (Studi Pada Pemerintah Kota Bengkulu)461BaruStatus usulan:0225057501UNIVERSITAS MUHAMMADIYAH BENGKULU021010Penelitian Dosen PemulaKode:MARZUKIPrototype Model Sistem Klasifikasi Tingkat Temuan Internal Audit Berbasis Case-Based Reasoning pada Manajemen Mutu Pendidikan462BaruStatus usulan:0215067304UNIVERSITAS BANDAR LAMPUNG021012Penelitian Dosen PemulaKode:FENTY ARIANIAlgoritma Fuzzy Inference System metode Tsukamoto untuk Rekomendasi Pemilihan Jurusan463BaruStatus usulan:0215108402UNIVERSITAS BANDAR LAMPUNG021012Penelitian Dosen PemulaKode:58


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAGUS MULYANIPengaruh Produk dan Harga Karet terhadap Perubahan Pendapatan Masyarakat di Wilayah Lebung Itam Kec. TulungSelapan Kab. Ogan Komering Ilir (OKI) Palembang472BaruStatus usulan:0216087101UNIVERSITAS PGRI PALEMBANG021016Penelitian Dosen PemulaKode:ILHAMSYAHAnalisis Faktor-faktor Kualitas Pelayanan terhadap Loyalitas PAsien di RS. Kusta Dr. Rivai Abdullah Kab. Banyuasin Provinsi Sumatera Selatan 473BaruStatus usulan:0218077201UNIVERSITAS PGRI PALEMBANG021016Penelitian Dosen PemulaKode:DEWI APRIDAPERSEPSI PENGGUNA KENDARAAN DINAS TERHADAP KEBIJAKAN DAN PENGELUARAN PEMERINTAH BERUPA PENGGUNAAN BAHAN BAKAR PERTAMAX PADA KENDARAAN DINAS DI SKPD PEMERINTAH KOTA BENGKULU474BaruStatus usulan:0209048102UNIVERSITAS RATU SAMBAN021018Penelitian Dosen PemulaKode:Dra LINDA ASTUTI M.SiPengaruh Mode Pakaian Pokok dan Ketebalan Huruf pada Daya Tarik Buku Komik dan Peningkatan Pengetahuan Ibu-Ibu tentang Gizi Balita di Kecamatan Arga Makmur Kabupaten Bengkulu Utara475BaruStatus usulan:0231106603UNIVERSITAS RATU SAMBAN021018Penelitian Dosen PemulaKode:MEKARRIA PANGARIBUAN S.T., M.TBAJA RINGAN SEBAGAI PENGGANTI KAYU DALAM PEMBUATAN RANGKA ATAP BANGUNAN RUMAH MASYARAKAT476BaruStatus usulan:0209067502UNIVERSITAS RATU SAMBAN021018Penelitian Dosen PemulaKode:PARWITOAPLIKASI BEBERAPA BIOAKTIVATOR MIKROORGANISME LOKAL TERHADAP PERTUMBUHAN DAN PRODUKSI SELADA (Lactuca sativa L.)477BaruStatus usulan:0226058201UNIVERSITAS RATU SAMBAN021018Penelitian Dosen PemulaKode:EDI SUSILOPEMANFAATAN LIMBAH BIOGAS YANG DIPERKAYA MOL PADA WAKTU DAN DOSIS APLIKASI YANG BERBEDA UNTUK PENINGKATKAN HASIL SELADA (Lactuca sativa L.)478BaruStatus usulan:0212047701UNIVERSITAS RATU SAMBAN021018Penelitian Dosen PemulaKode:ITRYAH S.Psi.,MAStudi Korelasi Antara Pengaturan Diri DenganKebiasaan Belajar Pada Mahasiswa Di Kotamadya Palembang479BaruStatus usulan:0228098001UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:60

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASYAHRIL RIZALAnalisis Penerapan Metode Link Layer Pada Radius Server Untuk Meningkatkan Kinerja Jaringan WLAN (Studi Kasus Perusahaan Pengguna Radius Server/Hotspot)480BaruStatus usulan:0223047003UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:MUJI GUNARTO S.Si, M.SiPemetaan Program Studi pada Perguruan Tinggi Swasta di Kota Palembang Berdasarkan Jumlah Mahasiswa (Studi pada PTS di Kota Palembang)481BaruStatus usulan:0212057403UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:TITA RATNA WULANDARIANALISA PENGARUH LATAR BELAKANG ILMU PENDIDIKAN GURU BAHASA INGGRIS TERHADAP HASIL BELAJAR BAHASA INGGRIS SISWA/SISWI SEKOLAH DASAR DI WILAYAH SUMATERA SELATAN482BaruStatus usulan:0222038702UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:HADI SYAPUTRAEVALUASI PENGGUNAAN SISTEM PAKET APLIKASI SEKOLAH TERHADAP PENINGKATAN MUTU PELAYANAN PENDIDIKAN SMA NEGERI DI PALEMBANG483BaruStatus usulan:0231108302UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:ARI MUZAKIR M.CsImplementasi E-Learning Berbasis Model View Controller (MVC) Pada MAN 1 Pangkalan Balai Dengan Metode Prototyping Berbasis WEB484BaruStatus usulan:0223128701UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:Drs. MUKRAN M.B.AAnalisa Dampak Perkembangan Sungai Musi Sebagai objek Wisata terhadap Peningkatan Pendapatan Masyarakat di Pinggiran Sungai Musi di Kota Palembang.485BaruStatus usulan:0230076101UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:MARLINDAWATI MM., M.Kom.PEMBUATAN MODEL DATA MINING DALAM PENGELOMPOKAN MINAT BELAJAR MAHASISWA DENGAN METODE CLUSTERING (STUDI KASUS: JURUSAN SISTEM INFORMASI UNIVERSITAS BINADARMA)486BaruStatus usulan:0224037201UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:TRISNINAWATIPeran Rencana Bisnis Sebagai Alat untuk meningkatkan Keberhasilan usaha (Studi Kasus UMKM dibawah Binaan Bina Darma Enterpreneurship Center (BDEC))487BaruStatus usulan:0220076702UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:61

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAADE PUTRAAnalisis Penerimaan Pengguna Akhir Dengan Menggunakan Technology Acceptance Model Dan End User Computing Satisfaction Terhadap Penerapan E-Learning Pada Universitas Bina Darma Palembang488BaruStatus usulan:0220057902UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:SITI NURHAYATI NAFSIAH S.E., M.Si.Efektivitas Sistem Pengendalian Manajemen Terhadap Kinerja Strategic Supplay Relationship Dengan Kerja Sama Sebagai Variabel Intervening (Studi Kasus Rumah Kota DI Palembang)489BaruStatus usulan:0215047001UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:WIDYANTOALAT DETEKSI KEBOCORAN TABUNG GAS ELPIJI BERBASIS MIKROKONTROLER PIC16F84490BaruStatus usulan:0224126901UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:KIKY RIZKY NOVA WARDANI M.KOMSTRUKTURAL EQUATION MODELING PADA PERHITUNGAN INDEKS KEPUASAN PELANGGAN (STUDI KASUS : MAHASISWA FAKULTAS ILMU KOMPUTER TERHADAP OPERATOR SELULER)491BaruStatus usulan:0225118702UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:NORMALIATY FITHRI ST.,M.MPENGEMBANGAN EMERGENCY LAMP DENGAN LED MENGGUNAKAN METODE QUALITY FUNCTION DEPLOYMENT (QFD492BaruStatus usulan:0227097503UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:MARIA ULFA M.KomEVALUASI USABILITY SISTEM E-LEARNING SEBAGAI APLIKASI PENDUKUNG PROSES PEMBELAJARAN DI PERGURUAN TINGGI MENGGUNAKAN USE QUESTIONNAIRE 493BaruStatus usulan:0225028304UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:QORIANI WIDAYATIANALISIS PENERIMAAN APLIKASI KAMUS ISTILAH AKUNTANSI PADA SMARTPHONE MENGGUNAKAN METODE UTAUT494BaruStatus usulan:0213108403UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:SUYANTO MM.,M.KOMPengembangan Aplikasi Mobile Pencarian Halte Transmusi Palembang Berbasis Lokasi495BaruStatus usulan:0225087301UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:62

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANYIMAS SOPIAHAPLIKASI LATIHAN TES IQ MENGGUNAKAN ANDROID496BaruStatus usulan:0218017501UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:IRMAN EFFENDYRANCANG BANGUN APLIKASI LOKASI WISATA KOTA PALEMBANG BERBASIS MOBILE497BaruStatus usulan:0214068601UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:RINA OKTAVIANA S.Psi.,MAANALISIS DAYAN ERGONOMIS TERHADAP PRODUKTIVITAS PADA PENGRAJIN SONGKET DI DAERAH SUNGKI PALEMBANG498BaruStatus usulan:0216107703UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:DENI ERLANSYAH MM.,M.KomAlat Bantu kerja (JIG) Untuk Mengecek Kualitas Speaker Berbasis Mikrokontroler499BaruStatus usulan:0215107601UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:ILMAN ZUHRI YADIANALISIS FORENSIK DAN MOBILE SECURITY DARI BERBAGAI ANDROID PLATFORM500BaruStatus usulan:0229047501UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:MEGAWATYAnalisis Kualitas Portal E-dukasi.Net Dengan Menggunakan Metode WebQual 4.0(Studi Kasus Pada SMA Negeri di kota Palembang)501BaruStatus usulan:0213028701UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:WINOTO CHANDRADAMPAK MEROKOK TERHADAP PRESTASI BELAJAR SISWA SMA DI PALEMBANG502BaruStatus usulan:0209125801UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:EKA PUJI AGUSTINIdesain dan implementasi wireless roaming pada jaringan kampus503BaruStatus usulan:0207087801UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:63

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADINA MELLITA M.Ec.IMPLEMENTASI TECHNOPRENEURSHIP PADA PEREMPUAN PEMILIK UKM DI KOTA PALEMBANG504BaruStatus usulan:0206077701UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:EDI SURYA NEGARAAnalisis dan Perancangan Arsitektur Teknologi Informasi Berbasis Cloud Computing Untuk Institusi Perguruan Tinggi di Sumatera Selatan505BaruStatus usulan:0205038803UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:EVI YULIANINGSIH M.KomANALISIS TERHADAP PERILAKU BERTRANSAKSI ONLINE PENGGUNA FACEBOOK COMMERCE506BaruStatus usulan:0208077801UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:SUSAN DIAN PURNAMASARIBusiness Intelligence untuk penentuan jumlah kelas pada penjadwalan mata kuliah507BaruStatus usulan:0212047101UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:RIA ANDRYANIModel Manajemen Risiko pada Penerapan Cloud Computing untuk Sistem Informasi di Perguruan Tinggi menggunakan Framework Octave508BaruStatus usulan:0203107801UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:KURNIAWANKAJIAN MENGENAI PENGGUNAAN E-LEARNING DI KALANGAN MAHASISWA PERGURUAN TINGGI SWASTA DI KOTA PALEMBANG509BaruStatus usulan:0209087902UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:S.Kom. AFRIYUDI M.Kom.Pengembangan Sistem Informasi Eksekutif berbasis Android pada Jaringan Virtual Private Network (VPN)510BaruStatus usulan:0202047501UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:FATMASARI MM., M.KOMSTUDI KOMPARATIF METODE UTAUT DAN TAM TERHADAP PENERAPAN SISTEM INFORMASI AKADEMIK (STUDI KASUS: SISTEM INFORMASI AKADEMIK UNIVERSITAS BINA DARMA PALEMBANG)511BaruStatus usulan:0202017801UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:64

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABAYU HARDIONOAnalisis Aktivitas Fisik Lari Memindahkan Cone Terhadap Kebugaran Jasmani Dengan Pendekatan Fisiologi512BaruStatus usulan:0201118502UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:VERAWATY S.E.,Ak.,M.Sc.DETERMINAN AKSESIBILITAS INFORMASI KEUANGAN MELALUI E-GOVERNMENT PEMERINTAH DAERAH DI INDONESIA (TELAAH PENERAPAN UNDANG-UNDANG NO. 14 TAHUN 2008 TENTANG KETERBUKAAN INFORMASI PUBLIK)513BaruStatus usulan:0017028201UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:HASTARI MAYRITAIMPLEMENTASI MODEL CIRC DALAM PEMBELAJARAN MENULIS WACANA EKSPOSITORIS SISWA SMA KELAS XI KECAMATAN SEBERANG ULU 2 514BaruStatus usulan:0201088504UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:SITI SAUDAPENGUKURAN KUALITAS LAYANAN WEBSITE PERGURUAN TINGGI DENGAN MENGGUNAKAN METODE WEBSQUAL 515BaruStatus usulan:0211118601UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:IRWANSYAH MM.,M.KOMAnalisis Kualitas Jaringan Internet Dengan Menggunakan Metode QOS (Quality of Service) pada Jardiknas Schoolnet SMU di Kota Palembang516BaruStatus usulan:0211117401UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:MUHAMMAD TITAN TERZAGHIDampak Penerapan IFRS Pada Figur Dan Rasio Laporan Keuangan Pada Sektor Perbankan BUMN (Studi Kasus Perusahaan yang terdaftar di Bursa Efek Indonesia)517BaruStatus usulan:0030057901UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:RASMILA M.KomPENGEMBANGAN WEB ADVERTISING MENGGUNAKAN HIERARKI MODEL VIEW CONTROLLER (HMVC) DENGAN FRAMEWORK CODEIGNITER PADA NIAGA BINADARMA518BaruStatus usulan:0210048501UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:CITRA INDAH MERINAAnalisis Determinan Pengungkapan Corporate Social Responsibility (CSR) Perusahaan Go Public di Indonesia519BaruStatus usulan:0025098201UNIVERSITAS BINA DARMA021019Penelitian Dosen PemulaKode:65

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAKHAIRIL S.Kom.,M.KomImplementasi Intrusion Detection System sebagai Keamanan Web Server pada Universitas Dehasen Bengkulu520BaruStatus usulan:0213047501Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:Ir. HERLINA M.Si.Efektivitas Ekstrak Bahan Organik dalam Invigorasi Benih Kedelai (Glycine max L. Merril)521BaruStatus usulan:0201086602Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:LINA WIDAWATIPreferensi Panelis dan Efektivitas Penggunaan Bahan Penstabil terhadap Mutu Sambal Hijau Tempoyak522BaruStatus usulan:0216118402Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:LINA TRI ASTUTY BERU SEMBIRINGEfektivitas Cognitive Strategies Dalam Meningkatkan Kemampuan Pemahaman Membaca Bahasa Inggris di Universitas Dehasen Bengkulu523BaruStatus usulan:0207128501Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:VETHY OCTAVIANIRUANG CALON LEGISLATIF PEREMPUAN DALAM MEDIA MASSA524BaruStatus usulan:0215108401Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:AHMAD SOLEHDISPARITAS PENDAPATAN DAN ARAH KEBIJAKAN PEMBANGUNAN EKONOMI PROVINSI DI WILAYAH BELAJASUMBA525BaruStatus usulan:0201128101Universitas Dehasen Bengkulu021023Penelitian Dosen PemulaKode:MUHAMMAD WADUDAnalisis faktor internal dan eksternal : penghambat dan solusi perkembangan koperasi (studi pada koperasi unit desa di Kabupaten Musi Banyuasin526BaruStatus usulan:0007077501Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:AJI WINDU VIATRASeni Kerajinan Songket Kampoeng Tenun Di Indralaya, Palembang527BaruStatus usulan:0221017901Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:66

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASURYATIPenetuan minat dan bakat calon mahasiswa untuk memilih program studi pada Universitas IGM Palembang menggunakan metode CBR (case based reasioning)528BaruStatus usulan:0222126905Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:HERDINHubungan Perencanaan Strategi SI/TI Terhadap Kinerja Organisasi di Tingkat Universitas529BaruStatus usulan:0228027201Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:SRY MULYA KURNIATIDEVELOPING THE SECOND SEMESTER STUDENTS’ WRITING SKILL OF THE INFORMATIC ENGINEERING STUDY PROGRAM BY USING DIALOGUE JOURNAL WRITING (DJW) THROUGH E-MAIL AT INDO GLOBAL MANDIRI UNIVERSITY PALEMBANG530BaruStatus usulan:0227098601Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:ENDAH DEWI PURNAMASARIPengaruh Faktor Ekonomi Makro terhadap Kinerja Keuangan Bank Umum Konvensional dan Bank Umum Syariah Periode 2008-2012531BaruStatus usulan:0204128602Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:EMILIA GUSTINI SE, M.SiFaktor-Faktor Yang Mempengaruhi Minat Penggunaan Sistem Informasi Akuntansi Pada Perusahaan Manufaktur Yang Terdaftar di Bursa Efek Indonesia.532BaruStatus usulan:0230087501Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:HASTHA SUNARDIPembangunan m-Bekam Berbasis Sistem Pakar533BaruStatus usulan:0210076301Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:Ir. RUSMAN ASRI M.T.KUAT TEKAN BETON MUTU TINGGI DENGAN PENAMBAHAN CONPLAST SP 337534BaruStatus usulan:0209055201Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:ENNY REKAWATITHE CORRELATION BETWEEN THE STUDENTS’ VOCABULARY MASTERY AND WRITING ACHIEVEMENT OF THE SECOND SEMESTER STUDENTS AT ECONOMICS MANAGEMENT STUDY PROGRAM IN INDO GLOBAL MANDIRI UNIVERSITY PALEMBANG535BaruStatus usulan:0210108304Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:67

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADHAMAYANTIPenentuan Pemberian Reward bagi Karyawan Berprestasi di Lingkungan Universitas Indo Global Mandiri dengan Algoritma C45536BaruStatus usulan:0209127902Universitas Indo Global Mandiri021024Penelitian Dosen PemulaKode:SUSHANTY SALEH S.Kom,M.T.IDesain Model Knowledge Manajement System Untuk Pembuatan Materi Ajar (Studi Kasus IBI Darmajaya)537BaruStatus usulan:0220087601Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:DODI YUDO SETYAWAN S.Si,M.T.IImplementasi Sensor SHT11 Untuk Akuisisi Data Suhu Tanah Sebagai Indikator Datangnya Gempa Bumi dengan Teknik Telemetri538BaruStatus usulan:0208108104Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:ITA FIONITA S.E.,M.MPENERAPAN SISTEM INFORMASI MANAJEMEN PADA USAHA KECIL MENENGAH DI PROVINSI LAMPUNG539BaruStatus usulan:0202108302Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:DEPPI LINDA S.Kom,M.T.IPEMANFAATAN METODE ANALYTICAL HIERARCHY PROSES UNTUK PROSES PEMBIMBING AKADEMIK(Studi kasus IBI Darmajaya)540BaruStatus usulan:0202097001Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:ANGGALIA WIBASURI M.MDeterminan Self Efficacy Dalam Kemandirian Belajar Mahasiswa Pada Perguruan Tinggi Swasta Di Bandar Lampung541BaruStatus usulan:0214028501Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:DELLI MARIAPENINGKATAN JIWA BERWIRAUSAHA MAHASISWA MELALUI PENDEKATAN SOSIODEMOGRAFI, SIKAP DAN KONDISI KONTEKSTUAL MAHASISWA PTS DI KOTA BANDAR LAMPUNG542BaruStatus usulan:0207098201Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:INDERA S.Kom,M.T.IRancang bangun aplikasi kamus bahasa lampung berbasis android543BaruStatus usulan:0201108002Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:68

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAASWIN S.E,M.MNilai Harapan Atas Layanan Jaminan Kesehatan di Bandar Lampung544BaruStatus usulan:0226038203Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:WINDA RIKA LESTARI M.MDiversifikasi Terhadap Risiko dan Kinerja Sektor Perbankan di Bursa Efek Indonesia (BEI)545BaruStatus usulan:0201087402Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:SUTEDI S.Kom., M.T.IPembangunan Cyber Market untuk Menunjang Pemasaran dan Promosi Produk Home Industri di Kawasan Sentra Keripik Bandar Lampung546BaruStatus usulan:0227077301Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:SEPTILIA ARFIDA S.Kom,M.T.IIMPLEMENTASI MEDIA PEMBELAJARAN TEKNIK PENGKODEAN BARCODE BERBASIS MULTIMEDIA DALAM MENINGKATKAN KUALITAS KEGIATAN BELAJAR MENGAJAR547BaruStatus usulan:0228087201Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:NOLITA YENI SIREGARMengukur Empowerment, Self Efficacy Dan Budaya Organisasi Terhadap Kepuasan Kerja Untuk Meningkatkan Kinerja Perguruan Tinggi Swasta Di Bandar Lampung 548BaruStatus usulan:0228107501Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:NURJOKO S.Kom.M.T.IRANCANG BANGUN MODEL SELEKSI PROGRAM WIRAUSAHA MAHASISWA BERBASIS WEB549BaruStatus usulan:0212067502Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:ANIK IRAWATI S.E,M.ScAnalisis Technology Acceptance Model Dalam Memahami Niat Perilaku Mahasiswa Untuk Menggunakan E-Learning (Studi Kasus Pada PTS se-Bandar Lampung)550BaruStatus usulan:0221018101Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:SRI LESTARI S.Kom,M.CsModel Klasifikasi Kinerja Dan Seleksi Dosen Berprestasi Dengan Algoritma C45551BaruStatus usulan:0206127601Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:69

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADONA YULIAWATI S.Kom.M.T.IPENERAPAN METODE AHP DALAM PENINGKATAN KUALITAS PEMETAAN JABATAN STRUKTURAL KARYAWAN (STUDI KASUS IBI DARMAJAYA)552BaruStatus usulan:0218077601Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:HANDOYO WIDI NUGROHO S.Kom.M.T.IReduksi Gangguan (Noise) Dengan Metode Filter Median Untuk Meningkatkan Akurasi Citra Sidik Jari Sebagai Human Identification553BaruStatus usulan:0205077201Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:MUHAMMAD RAFIQAnalisis Dampak Implementasi Praktek Kerja dan Pengabdian Masyarakat Terhadap Minat Mahasiswa Berwirausaha Ditinjau dari Sikap, Norma Subyektif, dan Kontrol Perilaku (Studi pada Mahasiswa Perguruan Tinggi di Bandar Lampung)554BaruStatus usulan:0430037803Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:CHAIRANIPENERAPAN ALGORITMA ITERATIVE DICHOTOMIZER 3 (ID3) UNTUK PENETAPAN KELAYAKAN PERUBAHAN STATUS KERJA KARYAWAN PADA PT. HANJUNG INDONESIA555BaruStatus usulan:0220058201Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:TM ZAINITUR VIRTUAL REALITY RUMAH ADAT BERBASIS VRML (Studi Kasus Rumah Adat Lampung)556BaruStatus usulan:0217127101Institut Informatika Dan Bisnis Darmajaya022001Penelitian Dosen PemulaKode:SUPRIYADI SE, MTAPERAN KOPERASI BERBASIS AGRIBISNISDALAM PERTUMBUHAN EKONOMI KOTA METRO557BaruStatus usulan:0027046201SEKOLAH TINGGI ILMU PERTANIAN DHARMA WACANA023006Penelitian Dosen PemulaKode:KRISNARINIPEMANFAATAN TEPUNG GANYONG DAN LIMBAH TULANG IKAN LELE SEBAGAI MAKANAN OLAHAN KAYA GIZI 558BaruStatus usulan:0207057401SEKOLAH TINGGI ILMU PERTANIAN DHARMA WACANA023006Penelitian Dosen PemulaKode:MUJIYATI S.Pd.Model Konseling melalui Teknik Assertive treaning untuk meningkatkan Self esteem siswa korban Bulyying (studi pengembangan pada siswa kelas XI SMK KH. Gholib tahun ajaran 2013/2014)559BaruStatus usulan:0212118501STKIP MUHAMMADIYAH PRINGSEWU023011Penelitian Dosen PemulaKode:70

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAS.Pd. EDY IRAWAN M.Pd.Pengembangan Teknik Permainan dalam Layanan Bimbingan Kelompok untuk Meningkatkan Penyesuaian Diri 560BaruStatus usulan:0212128001STKIP MUHAMMADIYAH PRINGSEWU023011Penelitian Dosen PemulaKode:MEYLINDA MULYATI S.T., M.T.Evaluasi Instalasi Pengolahan Air Limbah Rumah Sakit RK Charitas Palembang 561BaruStatus usulan:0212057702SEKOLAH TINGGI TEKNIK MUSI023014Penelitian Dosen PemulaKode:R KRISTOFORUS JAWA BENDIPERILAKU PENGGUNAAN FACEBOOK OLEH MAHASISWA562BaruStatus usulan:0221097701SEKOLAH TINGGI TEKNIK MUSI023014Penelitian Dosen PemulaKode:THERESIA SUNARNI M.T.EFEKTIVITAS PEMBELAJARAN DENGAN VIRTUAL REALITY (VR)563BaruStatus usulan:0205087504SEKOLAH TINGGI TEKNIK MUSI023014Penelitian Dosen PemulaKode:SUTIYO S.Sos., M.IP.ANALISIS PELAKSANAAN FUNGSI REKRUTMEN POLITIK PARPOL PESERTA PEMILU LEGISLATIF 2014(STUDI TERHADAP REKRUTMEN CALON ANGGOTA LEGISLATIF/CALEG DPRD KOTA METRO)564BaruStatus usulan:0202027701STISIPOL DHARMA WACANA023021Penelitian Dosen PemulaKode:HESTI WIDI ASTUTIMENGUKUR PELUANG DAN ACAMANAN BONUS DEMOGRAFI TERHADAP KUALITAS SUMBERDAYA MANUSIA DALAM PEMBANGUNAN EKONOMI DI BANDAR LAMPUNG565BaruStatus usulan:0201078101Sekolah Tinggi Ilmu Ekonomi Prasetiya Mandiri Lamp023039Penelitian Dosen PemulaKode:JHON NASYAROEKAKinerja perusahaan jika diukur dengan menggunakan metode Balance Scorecard di Bandar Lampung566BaruStatus usulan:0216067101Sekolah Tinggi Ilmu Ekonomi Prasetiya Mandiri Lamp023039Penelitian Dosen PemulaKode:HON HUSNIPeranan Dan Kesiapan Mahasiswa Jurusan Akuntansi Pada PTS (Perguruan Tinggi Swasta) Di Bandar Lampung Didalam Full Adoption International Financial Reporting Standards (IFRS) Di Indonesia” .567BaruStatus usulan:0001085913Sekolah Tinggi Ilmu Ekonomi Prasetiya Mandiri Lamp023039Penelitian Dosen PemulaKode:71

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMARIA JOSEPHINE TYRA SE., MM.Analisis Faktor-faktor yang Mempengaruhi Perilaku Pelanggan Belanja Online, Studi perilaku pelanggan belanja online di Palembang568BaruStatus usulan:0210016301SEKOLAH TINGGI ILMU EKONOMI MUSI023048Penelitian Dosen PemulaKode:DESY LESMANA M.Si.Corporate Social Responsibility, Good Corporate Governance dan Kinerja Keuangan569BaruStatus usulan:0021127002SEKOLAH TINGGI ILMU EKONOMI MUSI023048Penelitian Dosen PemulaKode:HERIYANTOANALISIS PENGARUH INDEKS HARGA KONSUMEN, JUMLAH UANG BEREDAR (M1), KURS RUPIAH, DAN INDEKS S&P 500 TERHADAP INDEKS HARGA SAHAM GABUNGAN: STUDI EMPIRIS PADA BURSA EFEK INDONESIA570BaruStatus usulan:0204058801SEKOLAH TINGGI ILMU EKONOMI MUSI023048Penelitian Dosen PemulaKode:FRANSISKA SOEJONO SE., MSC.Kompetensi, Karakteristik Wirausaha dan Kinerja Bisnis: Studi Pada Usaha Pempek di Palembang 571BaruStatus usulan:0216117701SEKOLAH TINGGI ILMU EKONOMI MUSI023048Penelitian Dosen PemulaKode:YOHANES ANDRI P BERNADUS S.E.,M.Sc.,AK.Pengaruh Corporate Social Responsibility Berbasiskan Karakteristik Social Bank Terhadap Kinerja Perusahaan Perbankan Di Bursa Efek Indonesia572BaruStatus usulan:0203087701SEKOLAH TINGGI ILMU EKONOMI MUSI023048Penelitian Dosen PemulaKode:CHAIRI ZAMANKOMBINASI METODE PENGUKURAN STRES KERJA DOSEN TETAP STIK BINA HUSADA TAHUN 2014573BaruStatus usulan:0229085201SEKOLAH TINGGI ILMU KESEHATAN BINA HUSADA023057Penelitian Dosen PemulaKode:SITI KHOIRINApengaruh sistem pengukuran kinerja terhadap kejelasan peran dan kinerja manajer (studi pada manajer perbankan)574BaruStatus usulan:0217096801SEKOLAH TINGGI ILMU EKONOMI MITRA023073Penelitian Dosen PemulaKode:NOVALITAAnalisis Implementasi Sistem Informasi AkuntansiTerhadap Kinerja Keuangan Pada Lembaga Keuangan Koperasi Di Propinsi Lampung575BaruStatus usulan:0229117601SEKOLAH TINGGI ILMU EKONOMI MITRA023073Penelitian Dosen PemulaKode:72

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUSI INDRIYANI M.Si.Pengaruh Penanganan Keluhan (Complaint Handling) Terhadap Kepercayaan Dan Komitmen Mahasiswa Pada Perguruan Tinggi Swasta Di Bandar Lampung576BaruStatus usulan:0209038103SEKOLAH TINGGI ILMU EKONOMI MITRA023073Penelitian Dosen PemulaKode:SURYANI SKM, M.KesFAKTOR RISIKO LINGKUNGAN YANG BERHUBUNGAN DENGAN KEJADIAN PNEUMONIA PADA BALITA DI WILAYAH KERJA PUSKESMAS SUKAMERINDU KOTA BENGKULU577BaruStatus usulan:0218077503STIKES TRI MANDIRI SAKTI BENGKULU023077Penelitian Dosen PemulaKode:YUSRAN FAUZI S.Si,M.KesHUBUNGAN SOSIAL EKONOMI DENGAN KEJADIAN DIARE PADA BALITA DI WILAYAH KERJA PUSKESMAS SUKAMERINDU KOTA BENGKULU578BaruStatus usulan:0207057701STIKES TRI MANDIRI SAKTI BENGKULU023077Penelitian Dosen PemulaKode:Ns PAWILIYAH S.Kep.MANPENGARUH PELATIHAN BERBASIS SIMULASI TERHADAP PENGETAHUAN DAN KETERAMPILAN KADER POSYANDU TENTANG DETEKSI DINI STATUS GIZI PADA BALITASTATUS GIZI PADA BALITA579BaruStatus usulan:0203078402STIKES TRI MANDIRI SAKTI BENGKULU023077Penelitian Dosen PemulaKode:MAUIZATUL HASANAH M.TPengaruh Metoda Ekstraksi Perkolasi Kontinyu dan Soxhlet Terhadap Rendemen dan Aktivitas Antioksidan Ekstrak Daun Jambu Biji Putih580BaruStatus usulan:0008088101Sekolah Tinggi Ilmu Farmasi Bhakti Pertiwi023083Penelitian Dosen PemulaKode:DIEN NOVITAANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI NILAI MAHASISWA(STUDI KASUS STMIK GI MDP) 581BaruStatus usulan:0229117801STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:MUHAMMAD RACHMADIAPLIKASI KEAMANAN PENUMPANG TAKSI BERBASIS ANDROID582BaruStatus usulan:0231127001STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:MUHAMMAD HAVIZ IRFANIAnalisis Critical Success Factors Kesuksesan Implementasi E-Learning Studi Kasus: Perguruan Tinggi Swasta di Palembang583BaruStatus usulan:0209087903STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:73

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJOHANNES PETRUSSistem Informasi Kontrol Kondisi Lalu Lintas Dengan Alat Simulasi Penangkap Gambar Plat Kendaraan Pelanggar Lampu Lalu Lintas (Studi Kasus: Kota Madya Palembang)584BaruStatus usulan:0217036301STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:DAFIDANALISIS SISTEM PENERAPAN E-LEARNING DENGAN MENGGUNAKAN METODE UTAUT (UNIFIED THEORY OF ACCEPTANCED USE OF TECHNOLOGY)( Studi Kasus : SMK NEGERI KOTA PALEMBANG)585BaruStatus usulan:0212127801STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:ERVI COFRIYANTIANALISIS PENGARUH MANAJEMEN PENGETAHUAN TERHADAP INOVASI USAHA KECIL MENENGAH (STUDI KASUS : UKM KOTA PALEMBANG)586BaruStatus usulan:0222128001STMIK GLOBAL INFORMATIKA MDP023084Penelitian Dosen PemulaKode:ARIE YANDI SAPUTRAPENERAPAN MOBILE VOTING BERBASIS WEB DAN WAP (WIRELESS APPLICATION PROTOCOL) DALAM PEMILIHAN KEPALA DESA DI KABUPATEN MUSI RAWAS587BaruStatus usulan:0229118501STMIK BINA NUSANTARA JAYA LUBUK LINGGAU023107Penelitian Dosen PemulaKode:SRI HARTATIMODEL PENENTUAN PROGRAM KARYA USAHA MANDIRI (KUM) POLA “GRAMEENBANK” MENGGUNAKAN METODE SAW SEBAGAI PEMBERDAYAAN SUMBERDAYA WANITA PEDESAAN KEARAH PEMBANGUNAN EKONOMI WILAYAH588BaruStatus usulan:0221037102STMIK Pringsewu023109Penelitian Dosen PemulaKode:EDIN SURDI DJATI KUSUMAANALISIS PERILAKU CALON MAHASISWA TERHADAP MINAT UNTUK MENJADI MAHASISWA DI SEKOLAH TINGGI ILMU EKONOMI MULTI DATA PALEMBANG MENGGUNAKAN METODE UNIFIED THEORY OF ACCEPTANCE AND USE OF TECHNOLOGY (UTAUT)589BaruStatus usulan:0203096901STIE Multi Data Palembang023113Penelitian Dosen PemulaKode:MULYATIAnalisis Implementasi Layanan Pengadaan Secara Elektronik (LPSE) Menggunakan Konsep Technology Acceptance Model (TAM) Studi Kasus: LPSE Pemerintah Kota Palembang)590BaruStatus usulan:0214098203STIE Multi Data Palembang023113Penelitian Dosen PemulaKode:SITI KHAIRANIPengaruh Kesiapan Pemerintah Kota Palembang Dalam Menerima Pengalihan PBB-P2 dan BPHTB Sebagai Pajak Daerah Terhadap Persepsi Wajib Pajak591BaruStatus usulan:0226027301STIE Multi Data Palembang023113Penelitian Dosen PemulaKode:74

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARETNO BUDI LESTARIAnalisis Pengaruh Kualitas Kewirausahaan Terhadap Kinerja Usaha Kecil dan Menengah (Studi Empiris Pada Industri Kerupuk Kemplang di Palembang)592BaruStatus usulan:0621058101STIE Multi Data Palembang023113Penelitian Dosen PemulaKode:RACHMAT DODI ARIESNA M.Pd.Pengembangan Model Pembelajaran Motorik Berbasis Permainan Pada Mata Pelajaran Pendidikan Jasmani Anak Tunagrahita 593BaruStatus usulan:0220038601STKIP Al Islam Tunas Bangsa023119Penelitian Dosen PemulaKode:NUREVA M.Pd.Kontribusi interaksi guru dan siswa dalam proses pembelajaran menggunakan alat peraga berupa minizoo pada mata pelajaran IPA terhadap hasil belajar siswa SD/MI594BaruStatus usulan:0207048101STKIP Al Islam Tunas Bangsa023119Penelitian Dosen PemulaKode:ALI MASHARI M.Pd.Perilaku guru setelah mengikuti diklat (Studi pada SDN 2 Gunung Terang)595BaruStatus usulan:0209056802STKIP Al Islam Tunas Bangsa023119Penelitian Dosen PemulaKode:MGS. M. ILYASIMPLEMENTASI KESELAMATAN DAN KESEHATAN KERJA DI RUMAH SAKIT (K3) RS596BaruStatus usulan:0211097802Apikes W idya Dharma024034Penelitian Dosen PemulaKode:ABDUL RAHMANPerancangan dan Implementasi Jaringan Wireless LAN Rt/Rw Net dengan Identifikasi Kartu Keluarga Berbasis Mikrotik597BaruStatus usulan:0214047201AKADEMI MANAJEMEN INFORMATIKA DAN KOMPUTER MDP024044Penelitian Dosen PemulaKode:PUJIANTO S.Kom., M.CsRANCANG BANGUN SISTEM INFORMASI MANAJEMEN SEKOLAH BERBASIS CLIENT/SERVER 598BaruStatus usulan:0205047901AMIK AKMI024063Penelitian Dosen PemulaKode:ENI CAHYANI S.EPengaruh motivasi dan kepuasan kerja terhadap kualitas pelayanan Internal tenaga Pendidik pada Politeknik Swasta di Sumatera Selatan 599BaruStatus usulan:0216128102POLITEKNIK ANIKA PALEMBANG025002Penelitian Dosen PemulaKode:75

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFIRI PUTRA S.H.Pengaruh jumlah dan kepatuhan wajib pajak orang pribadi terhadap penerimaan pajak dengan pemoderasi penghasilan pajak pada Kanwil Direktorat Jenderal Pajak Sumsel dan Kepulauan Babel600BaruStatus usulan:0229026802POLITEKNIK ANIKA PALEMBANG025002Penelitian Dosen PemulaKode:IKA YULIASARIDISEMINASI INFORMASI POLITIK DALAM MEDIA MASSA(Wacana tentang Partisipasi Politik Masyarakat dalam Suratkabat Radar Bogor periode Maret 2014 -Mei 2014)601BaruStatus usulan:0022077402UNIVERSITAS JAYABAYA031006Penelitian Dosen PemulaKode:WINARNIKESETARAAN JENDER DALAM PESAN MEDIA CETAK (Analisis Isi Pesan Nilai Jender dalam Rubrik Peristiwa di Tabloid Nova Periode Desember 2013 s/d Januari 2014)602BaruStatus usulan:0006106706UNIVERSITAS JAYABAYA031006Penelitian Dosen PemulaKode:YB ANDRE MARVIANTAPengaruh Kepuasan Mahasiswa terhadap Citra Program Studi, Citra Perguruan Tinggi dan Keluhan Mahasiswa serta implikasinya pada Loyalitas Mahasiswa603BaruStatus usulan:0309016601UNIVERSITAS KRISTEN KRIDA WACANA031010Penelitian Dosen PemulaKode:FITRIA HIDAYANTI M.Si.Perancangan Sel Surya pada Lampu Belajar604BaruStatus usulan:0304097802UNIVERSITAS NASIONAL031012Penelitian Dosen PemulaKode:ARIS GUNARYATI S.Si.PEMODELAN FORECASTING CONTAINER THROUGHPUT DENGAN METODE ARIMA-BOX JENKINS, JARINGAN SYARAF TIRUAN DAN HYBRIDA ARIMA-BOX JENKINS-JARINGAN SYARAF TIRUAN605BaruStatus usulan:0313087705UNIVERSITAS NASIONAL031012Penelitian Dosen PemulaKode:FEBRIA ANITA S.Si., M.Sc.ESTIMASI ALIRAN SUNGAI BAWAH TANAH DI DAERAH DENGOK DAN NGREJOK WETAN GUNUNG KIDUL, MENGGUNAKAN METODE VLF-EM DAN VLF-EM-VGRAD606BaruStatus usulan:0328028501UNIVERSITAS NASIONAL031012Penelitian Dosen PemulaKode:NUR HAYATI S.Si., M.T.I.Implementasi Keaamanan Nomor Serial Sistem Operasi Windows 7 Menggunakan Algoritma Data Encryption Standard (DES) dan Rivest-Shamir Adleman (RSA) dengan Persamaan Lorenz607BaruStatus usulan:0316068402UNIVERSITAS NASIONAL031012Penelitian Dosen PemulaKode:76


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFIRSAN NOVAKinerja Perusahaan TV Berbayar (Pay TV)di Indonesia: Kajian terhadap Daya Tarik Pasar, Kompetensi Inti Perusahaan dan Penciptaan Nilai616BaruStatus usulan:0324117502UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:JUARIAH S.S., M.A.Pengaruh Bahasa Ibu Terhadap penyebutan kata ganti orang pertama, kedua dan ketiga pada pengunaan Bahasa Jepang dalam kalimat deskriptif – Fokus Pada Pemelajar di Indonesia Tingkat Menengah ke Atas –617BaruStatus usulan:0321117502UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:ADAM ARIF BUDIMANPemanfaatan Augmented Reality Berbasis Mobile untuk Pembelajaran Perangkat Keras Komputer sebagai Penunjang Mata Kuliah Arsitektur dan Organisasi Komputer618BaruStatus usulan:0413017903UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:FANNY OCTAVIANIKAJIAN PENGELOLAAN LIMBAH INDUSTRI GALANGAN KAPAL619BaruStatus usulan:0315106705UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:Dra. KURNIA IDAWATI M.Si.Disonansi Kognitif, Konsep Diri, dan Pembenaran Internal dan Eksternal dalam Hubungannya dengan Mencontek dan Plagiat di Kalangan Mahasiswa 620BaruStatus usulan:0313066401UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:RR APRILIYA DWI PPengaruh Sistem Fonologi Bahasa Pertama terhadap Pembelajaran Bahasa Kedua:Studi Kasus pada Penutur Bahasa Jepang621BaruStatus usulan:0310047604UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:LINDA NUR AFIFAAnalisis Hubungan Strategi Knowledge Management Terhadap Penjaminan Mutu Internal Perguruan Tinggi Serta Dampaknya Terhadap Kemajuan Kegiatan Akademik622BaruStatus usulan:0307047902UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:ADE SUPRIYATNA ST., MTPENGUKURAN BEBAN KERJA OPTIMAL PADA USAHA MIKRO PENGERAJIN KAYU DENGAN NATIONAL INSTITUTE FOR OCCUPATIONAL AND HEALTH623BaruStatus usulan:0306097401UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:78

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAC DEWI HARTATI S.S., M.Si.Klenteng sebagai wujud akulturasi budaya Cina dan Indonesia624BaruStatus usulan:0303027206UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:DRS EKO BUDI WAHYONO MTPengenalan Pola Lingkaran Segitiga dan Persegiempat Dengan Mempergunakan Algoritma Jaringan Saraf Tiruan Perseptron Lapis Jamak625BaruStatus usulan:0013105902UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:MOHAMMAD DANIL ARIFINANALISA KEGAGALAN SISTEM PELUMASAN DAN PEMILIHAN METODE PERAWATAN MOTOR INDUK DI KAPAL MENGGUNAKAN FAILURE MODE AND EFFECT ANALISYS (FMEA) 626BaruStatus usulan:0317078701UNIVERSITAS DARMA PERSADA031023Penelitian Dosen PemulaKode:ENDANG PURWANINGSIHPOTENSI DAN STRATEGI PENGEMBANGAN OBAT/JAMU TRADISIONAL MENUJU INDUSTRI OBAT HERBAL DI JAWA TENGAH DAN JAWA TIMUR627BaruStatus usulan:0304096806UNIVERSITAS YARSI031026MP3EIKode:RENI NURJASMIPengaruh Jenis Ikan dan Media Tanam Terhadap Pertumbuhan dan Hasil Tanaman Sayuran Buah Pada Sistim Akuaponik628BaruStatus usulan:0301018105UNIVERSITAS RESPATI INDONESIA031027Penelitian Dosen PemulaKode:RENATA KOMALASARITerapi Stimulasi Kognitif Lanjutan Pada Lanjut Usia629BaruStatus usulan:0307067702UNIVERSITAS PELITA HARAPAN031034Penelitian Dosen PemulaKode:DAME ELYSABETH TUTY ARNA ULY TEfektifitas Sosialisasi deteksi kejadian Stroke : FAST Pre Hospital Assessment pada tenaga kesehatan di puskesmas kabupaten Tangerang.630BaruStatus usulan:0324118103UNIVERSITAS PELITA HARAPAN031034Penelitian Dosen PemulaKode:MERI FUJI SIAHAANKompetensi Pedagogik Guru SD yang telah lulus sertifikasi di Kecamatan Kelapa Dua Kabupaten Tangerang631BaruStatus usulan:0312078001UNIVERSITAS PELITA HARAPAN031034Penelitian Dosen PemulaKode:79

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADr. HAMZAH AFANDI ST., MT.Disain dan Implementasi RFID berbasis teknologi CMOS632BaruStatus usulan:0329047303UNIVERSITAS GUNADARMA031037Riset Andalan Perguruan Tinggi dan IndustriKode:HANNY NURLATIFAH“Analisis Keputusan Pembelian Konsumen Terhadap Kepemilikan Sertifikat Halal MUI Dan Brand Credibility Pada Restoran Siap Saji” 633BaruStatus usulan:0326087605UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:SYURMITADelay Dalam Penyampaian Laporan Keuangan Pemerintah Daerah (LKPD): Studi Akuntabilitas dan Transparansi Keuangan Publik634BaruStatus usulan:0308128401UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:NINA ALIA ARIEFAMotif Dalam Cerita Rakyat Jepang635BaruStatus usulan:0319058102UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:RIRIS LINDIAWATI PUSPITASARIModifikasi media tanam Pleurotus ostreatus dan Potensinya sebagai nutrisi pertumbuhan pada Mus musculus636BaruStatus usulan:0307057905UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:Ir. WINANGSARI PRADANI MT.PEMILIHAN ORDE B-TREE SECARA OTOMATIS UNTUK EFISIENSI PENCARIAN DATA PADA STRUKTUR INDEKS SISTEM PENGOLAHAN DATA SEKUENS GENETIKA BERBENTUK FLATFILE637BaruStatus usulan:0417026702UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:GAYATRI ATMADIDeskripsi Penggunaan Media Komunikasi Untuk Memenuhi Kebutuhan Informasi Pariwisata Indonesia ( Studi Pada Kalangan Pekerja di Jakarta )638BaruStatus usulan:0331126404UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:VERA YULIANTIWebquest Pariwisata Jakarta sebagai Media Pembelajaran Bahasa Jepang639BaruStatus usulan:0307077305UNIVERSITAS AL-AZHAR INDONESIA031044Penelitian Dosen PemulaKode:80

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADICKY HIDA SYAHCHARIPengaruh Motivasi Konsumen, Kualitas Pelayanan dan Kepuasan terhadap Loyalitas Konsumen Futsal di DKI Jakarta640BaruStatus usulan:0328127105UNIVERSITAS TAMA JAGAKARSA031050Penelitian Dosen PemulaKode:SRI W RAHMAWATISTRATEGI PEMECAHAN MASALAH (COPING STRATEGY) UNTUK MENINGKATKAN RESILIENSI SISWA SMA MENGHADAPI UJIAN NASIONAL641BaruStatus usulan:0309066703UNIVERSITAS TAMA JAGAKARSA031050Penelitian Dosen PemulaKode:JOKO PRIHARTONO ST, MTPENGARUH GAME ONLINE TERHADAP PENGUASAN TEKNOLOGI INFORMASI BAGI SISWA-SISWI SMU/SMK 642BaruStatus usulan:0324067301UNIVERSITAS TAMA JAGAKARSA031050Penelitian Dosen PemulaKode:NINUK WILIANIAnalisa Model Pembelajaran Inovatif Dalam Meningkatkan Standard Kualitas Pendidikan Nasional 643BaruStatus usulan:0306057801INSTITUT SAINS DAN TEKNOLOGI NASIONAL032004Penelitian Dosen PemulaKode:Drs. TAHOMA SIREGAR M.Si.AptAnalisis Dosis Terapi Ruamatan Metadon setelah 2 minggu dan 3-6 bulan yang disertai terapi Antiretroviral (ARV), antituberkulosis di RSPI Sulianti Saroso / RSUPN Dr. Ciptomangunkusumo, Jakarta644BaruStatus usulan:0328086503INSTITUT SAINS DAN TEKNOLOGI NASIONAL032004Penelitian Dosen PemulaKode:SITI NURMIATIRANCANG BANGUN APLIKASI AKADEMIK “E-SMART” KNOWLEDGE MANAGEMENT SYSTEM BERBASIS WEB645BaruStatus usulan:0402107703INSTITUT SAINS DAN TEKNOLOGI NASIONAL032004Penelitian Dosen PemulaKode:ARYO NUR UTOMO ST, M.KomAplikasi Pembangkit Token di Perangkat Mobile Untuk Otentifikasi (Alternatif Pengganti Hardware Token)646BaruStatus usulan:0319046803INSTITUT SAINS DAN TEKNOLOGI NASIONAL032004Penelitian Dosen PemulaKode:HUSNIAnalisis & Disain Arsitektur Laboratorium Simulasi Mekatronika Virtual Berbiaya Murah647BaruStatus usulan:0314077205INSTITUT TEKNOLOGI INDONESIA032006Penelitian Dosen PemulaKode:81

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr KATRI WIDAYANI MTINTEGRASI ENTRY POINT DATA PUSKESMAS dengan MEMBANGUN SOFTWARE PENGOLAHAN DATA648BaruStatus usulan:0013095901INSTITUT TEKNOLOGI INDONESIA032006Penelitian Dosen PemulaKode:FEBRI HIDAYATPENGARUH WAKTU EKSTRAKSI ZAT PEWARNA ALAMI MORIN DALAM SERBUK KAYU NANGKA DENGAN MENGGUNAKAN VARIASI PELARUT ORGANIK (ETANOL, ASETON dan HEKSANA)649BaruStatus usulan:0323026805Institut Sains dan Teknologi Al-Kamal032008Penelitian Dosen PemulaKode:ST AGUNG SISWAHYUUji Karakteristik (Selektifitas dan Kapasitas) Resin Penukar Anion Terhadap Larutan Karbonat-Bikarbonat650BaruStatus usulan:0315057802Institut Sains dan Teknologi Al-Kamal032008Penelitian Dosen PemulaKode:HASTHO SANTOSA ST STPengaruh Jenis dan Komposisi Aditif Terhadap Kualitas Polimer Linier Low Density Polyethylene (LLDPE)651BaruStatus usulan:0313048002Institut Sains dan Teknologi Al-Kamal032008Penelitian Dosen PemulaKode:ST ABDUL HALIMSTUDI PENDAHULUAN EFISIENSI TUNGKU PEMBAKARAN BERBAHAN BAKAR BIOMASSA BAGAS TEBU652BaruStatus usulan:0304077905Institut Sains dan Teknologi Al-Kamal032008Penelitian Dosen PemulaKode:Dra. MM TRI S MILDAWANI MAPERANAN PEMIMPIN CABANG DALAM PELATIHAN DAN PENGEMBANGAN FRONTLINER (Studi Kualitatif pada Bank BTN dengan Pendekatan Riset Tindakan Berbasis Soft Systems Methodology)653BaruStatus usulan:0312076001Institut Keu Perbankan Dan Inf Asia Perbanas032011Penelitian Dosen PemulaKode:IR. MERCURIUS BROTO LEGOWOModel Support Vector Machine Dengan Optimasi Parameter Menggunakan Algoritma Genetika Untuk Prediksi Laju Inflasi Di Indonesia654BaruStatus usulan:0321116401Institut Keu Perbankan Dan Inf Asia Perbanas032011Penelitian Dosen PemulaKode:PUJI HADIYATI S.E, M.SiPERBANDINGAN PERTUMBUHAN DAN KARAKTERISTIK PENYALURAN KREDIT BANK KONVENSIONAL DAN PEMBIAYAAN BANK SYARIAH DI INDONESIA PERIODE TAHUN 2009 - 2013655BaruStatus usulan:0303106801Institut Keu Perbankan Dan Inf Asia Perbanas032011Penelitian Dosen PemulaKode:82

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAA DEWANTORO MARSONO MBAAnalisis Faktor-faktor yang Mempengaruhi Pertumbuhan Dana Pihak Ketiga (Mudharabah) Pada Bank Syariah di Indonesia Periode 2009 - 2013656BaruStatus usulan:0330116502Institut Keu Perbankan Dan Inf Asia Perbanas032011Penelitian Dosen PemulaKode:ADHES GAMAYEL S.T,. M.TPENGARUH PEMASANGAN BLUFF BODY DAN VARIASI KOMPOSISI LIMBAH PASAR TERHADAP KARAKTERISTIK BIOBRIKET SERBUK KAYU657BaruStatus usulan:0322118204SEKOLAH TINGGI TEKNOLOGI JAKARTA033006Penelitian Dosen PemulaKode:YUSWANTO ANDONOPENGUJIAN PERFORMA GENERATOR HIDROGEN TYPE DRY CELL DENGAN SISTEM ELEKTROLISA H2O DAN KATALISATOR BAKING SODA658BaruStatus usulan:0031057201SEKOLAH TINGGI TEKNOLOGI JAKARTA033006Penelitian Dosen PemulaKode:FLOURIEN NURUL CHUSNAH S.E., M.SiIntellectual Capital dan Performance: Implementasi Korelasi Strategi Bisnis pada Perusahaan Go Public (Studi Kasus: Perusahaan Manufaktur yang Terdaftar di Bursa Efek Indonesia)659BaruStatus usulan:0301037701SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:SE DADE NURDINIAH M.AkANALISIS FAKTOR-FAKTOR YANG MEMILIKI KORELASI DENGAN KELELAHAN KERJA MELALUI INSTRUMEN ALAT UKUR KELELAHAN SUBYEKTIF660BaruStatus usulan:0304017501SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:SE. RIMI GUSLIANA MAIS M.Si.COMPARATION PERFORMANCE: OBLIGASI SYARIAH VERSUS OBLIGASI KONVESIONAL661BaruStatus usulan:0315087401SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:SE SULISTYOWATI M.AkAnalisis Implementasi PSAK 13 Konvergensi IFRS tentang Properti Investasi dan Pengaruhnya terhadap Laba Perusahaan pada Perusahaan yang Terdaftar di BEI662BaruStatus usulan:0326097701SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:SE. SAID KHAERUL WASIF Ak.Komparability Kinerja Koperasi Simpan Pinjam Pemda dan Swasta untuk memujudkan Kompetitive Advantage dan Good Governance Koperasi(Survey pada Koperasi Simpan Pinjam Swasta dan Pemerintah di Provinsi DKI Jakarta)663BaruStatus usulan:0320126901SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:83

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERNA LOVITA SE., Ak,. M.Ak.Studi Eksperimen : Peningkatan Kinerja Keuangan UKM Melalui Pengembangan Pengetahuan Dan Pelatihan Penggunaan Informasi Akuntansi(Studi Kasus Pada UKM Boneka di Bekasi)664BaruStatus usulan:0324107301SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:SE. GATOT PRABANTORO MM.Analisis Pemanfaatan Fasilitas Gratis Di Internet Sebagai Media Komunikasi Pemasaran Global UKM Di Indonesia (Studi Kasus UKM PIK Pulogadung)665BaruStatus usulan:0328076801SEKOLAH TINGGI ILMU EKONOMI INDONESIA033012Penelitian Dosen PemulaKode:LELA NURLAELA WATIAnalisis Faktor-Faktor Yang Mempengaruhi Kesulitan Keuangan Dan Kebangkrutan Perusahaan : Studi Kasus Perusahaan Yang Terdaftar Pada Jakarta Islamic Index666BaruStatus usulan:0307127801SEKOLAH TINGGI ILMU EKONOMI MUHAMMADIYAH JAKARTA033096Penelitian Dosen PemulaKode:- NOVA RINI SE, M.SiAnalisa Efektifitas Pengelolaan Keuangan dan Pengukuran Kinerja Badan Layanan Umum Daerah667BaruStatus usulan:0320108003SEKOLAH TINGGI ILMU EKONOMI MUHAMMADIYAH JAKARTA033096Penelitian Dosen PemulaKode:NOOR INDAH RAHMAWATI SE, MMAnalisis Program Corporate Social Responsibility (CSR) Perbankan Syariah Dalam Pengentasan Kemiskinan 668BaruStatus usulan:0024037701SEKOLAH TINGGI ILMU EKONOMI MUHAMMADIYAH JAKARTA033096Penelitian Dosen PemulaKode:MARLIANA SARIELECTRONIC WATER SENSOR DENGAN MENGGUNAKAN MIKROKONTROLER ARDUINO SEBAGAI UPAYA PERINGATAN BANJIR BAGI MASYARAKAT SEPANJANG DAERAH ALIRAN SUNGAI669BaruStatus usulan:0327037701SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:NOVI GUSTI PAHIYANTI STAnalisa Kinerja Relay Jarak Pada Saluran Transmisi Ganda 150 kV Antara GI Cikupa Dan GI Balaraja Terhadap Gangguan Arus Hubung Singkat670BaruStatus usulan:0301118501SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:LUQMAN ST.,M.KomUpaya meningkatkan efektifitas Informasi Jadwal Kuliah bagi mahasiswa dengan konsep “One Stop Information Center” Pada TV Informasi Perguruan Tinggi menggunakan Evaluasi Cognitive Walkthrough671BaruStatus usulan:0316067501SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:84

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMALINDA FUJIYANTI ST.,MTIAplikasi Penelusuran Jejak Studi Alumni Menggunakan Teknologi Berbasis Web Dalam Upaya Evaluasi dan Pengembangan Perguruan Tinggi Dalam Mengembangkan Kurikulum Sesuai Kebutuhan Pasar.studi kasus : Sekolah Tinggi Teknik - PLN (STT PLN) 672BaruStatus usulan:0326098101SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:ABDUL HARISSistem Kendali dan Pembatas Pemakaian Energi Listrik Berbasis WEB673BaruStatus usulan:0315038204SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:MEILIA NUR INDAH SUSANTI ST.,M.KomUpaya meningkatkan Manajemen Administrasi Pendidikan Jurusan Teknik Informatika dengan dirancang bangun program aplikasi pencarian surat keputusan menggunakan metode interpolasi674BaruStatus usulan:0318057601SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:EFY YOSRITA S.Si.,M.KomRancang Bangun Aplikasi Simulasi Sebagai Media Latihan Guna Mengurangi Penggunaan Kertas Untuk Materi Determinan dan Invers Matrik 675BaruStatus usulan:0314127401SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:Drs. PRAYUDI mPengaruh Retrofit Refrijeran R12, R134a dengan MC134 Terhadap Kinerja Mesin Pendingin Ruangan676BaruStatus usulan:0322056401SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:DIAN HARTANTI S.Kom.,MMSIPENGEMBANGAN APLIKASI MODUL PRAKTIKUM GERBANG LOGIKA AND, OR DAN NOT MENGGUNAKAN BAHASA PEMROGRAMAN VISUAL BASIC677BaruStatus usulan:0329098303SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:PUJI CATUR SISWIPRAPTINI ST.,MTIPerancangan Simulator Akar Persamaan menggunakan Iterasi Satu Titik berbasis Multimedia pada Mata Kuliah Metode Numerik di STT PLN 678BaruStatus usulan:0301027703SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:YESSY FITRIANI ST., M.KomAplikasi Kerahasiaan Data dengan menggunakan Metode Steganografi End of File (EOF) dan Kriptografi Rivest Shamir Adleman (RSA) Dalam Upaya Meningkatkan Pemahaman Mahasiswa Pada Mata Kuliah Keamanan Sistem Komputer Di STTPLN679BaruStatus usulan:0326058501SEKOLAH TINGGI TEKNIK PLN033104Penelitian Dosen PemulaKode:85

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHIDAYANI MKMPemanfaatan buku KIA oleh Ibu hamil dalam kesiapan menghadapi persalinan di Lenteng Agung II Jagakarsa680BaruStatus usulan:0331078102SEKOLAH TINGGI ILMU KESEHATAN INDONESIA MAJU033129Penelitian Dosen PemulaKode:RINDU SKM,M.KesPengembangan Pola Asuh dalam Kesehatan Anak pada Ibu Buruh Pabrik di Wilayah Cimanggis Depok681BaruStatus usulan:0320068101SEKOLAH TINGGI ILMU KESEHATAN INDONESIA MAJU033129Penelitian Dosen PemulaKode:Ns. DWI SETIOWATI M.KepStrategi Membangun Budaya Keselamatan Pasien dengan Kepemimpinan Transformasional Kepala Ruang di Rumah Sakit PMI Bogor682BaruStatus usulan:0627108304SEKOLAH TINGGI ILMU KESEHATAN INDONESIA MAJU033129Penelitian Dosen PemulaKode:RENI SULISTYOWATI SE, MMPerspektif Sahid International Management and Consultant Terhadap Daya Saing Destinasi di Indonesia683BaruStatus usulan:0312027109SEKOLAH TINGGI PARIWISATA SAHID033134Penelitian Dosen PemulaKode:HENDRA M.KOMSistem Penunjang Keputusan Pusat Kesehatan Masyarakat Kumuh Padat Kumuh Miskin Berdasarkan Data Mining Menggunakan Data Warehouse(Studi Kasus: Puskesmas Kampung Rawa)684BaruStatus usulan:0308087501STMIK NUSA MANDIRI033165Penelitian Dosen PemulaKode:REVIE FITRIA NASUTIONHUBUNGAN PENGETAHUAN, SIKAP IBU NIFAS DENGAN PEMBERIAN KOLOSTRUM PADA BAYI BARU LAHIR DI PUSKESMAS KECAMATAN DUREN SAWIT JAKARTA TIMUR685BaruStatus usulan:0327097702STIKES PERSADA HUSADA INDONESIA033170Penelitian Dosen PemulaKode:ELWINDRAANALISIS INDEKS KEPUASAN MASYARAKAT (IKM)TERHADAP PELAYANAN PUBLIK DI PUSKESMAS KECAMATAN PASAR REBO JAKARTA TIMUR TAHUN 2014686BaruStatus usulan:0331127303STIKES PERSADA HUSADA INDONESIA033170Penelitian Dosen PemulaKode:SITI RUKAYAHPengaruh Terapi Akupresur Terhadap Mual Muntah Akut Akibat Kemoterapi Pada Anak Dengan Leukemia Di RSUPN Ciptomangunkusumo Jakarta687BaruStatus usulan:0304037803STIKES PERSADA HUSADA INDONESIA033170Penelitian Dosen PemulaKode:86

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAELIYAFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN TINDAKAN PETUGAS KESEHATAN DI PUSKESMAS PASAR REBO JAKARTA TIMUR DALAM UPAYA PENCEGAHAN HIVAIDS 688BaruStatus usulan:0304026904STIKES PERSADA HUSADA INDONESIA033170Penelitian Dosen PemulaKode:HERLINAEVALUASI HASIL PENGOBATAN PASEN MDR TB DI PUSKESMAS KECAMATAN CIRACAS JAKARTA TIMURTAHUN 2013689BaruStatus usulan:0310067603STIKES PERSADA HUSADA INDONESIA033170Penelitian Dosen PemulaKode:WIDI DWI ASIARINI STFAKTOR – FAKTOR YANG MEMPENGARUHI STATUS GIZI ANAK SD 02 PAGI KELURAHAN DUKUH KEC. KRAMAT JATI JAKARTA TIMUR690BaruStatus usulan:0319126802STIKES MOHAMMAD HUSNI THAMRIN033172Penelitian Dosen PemulaKode:Ir AMIROHEvaluasi Pemenuhan Persyaratan GMP (Good Manufacturing Practices) dan Perencanaan Sistem HACCP (Hazard Analyis Critical Control Point) Unit Penyelenggaraan Makanan Di Rumah Sakit691BaruStatus usulan:0320065802STIKES MOHAMMAD HUSNI THAMRIN033172Penelitian Dosen PemulaKode:ATIKAH PUSTIKASARI SKMHUBUNGAN STRUKTUR KELUARGA TERHADAP ANGKA KEJADIAN KEKERASAN PSIKIS YANG DIALAMI ISTERI DALAM RUMAH TANGGA.692BaruStatus usulan:0306127303STIKES MOHAMMAD HUSNI THAMRIN033172Penelitian Dosen PemulaKode:MARYAM MURSADI M.Pd.Pendekatan Sistemik dalam Proyek Monitoring and Evaluation: Menggunakan Penelitian Desain Edukasional untuk Mengembangkan Suatu Model Monitoring and Evaluation Penyelenggaraan Pendidikan STEM di Indonesia693BaruStatus usulan:0322047808STKIP Kebangkitan Nasional033193Penelitian Dosen PemulaKode:Dr. ACHMAD SETYO HADI Drs., MSPortofolio Infrastruktur untuk Pencapaian MP3EI694BaruStatus usulan:0323086808STIE Prasetiya Mulya033204MP3EIKode:SURYANTOPENERAPAN ALGORITMA KLASIFIKASI DATA MINING DALAM PENENTUAN PEMBERIAN PINJAMAN KOPERASI695BaruStatus usulan:0306127401AMIK BSI Jakarta034110Penelitian Dosen PemulaKode:87

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHENDRA SUPENDARPENERAPAN METODE SVM UNTUK KLASIFIKASI RESIKO KREDIT KEPEMILIKAN KENDARAAN (MOTOR)696BaruStatus usulan:0310017402AMIK BSI Jakarta034110Penelitian Dosen PemulaKode:MOHAMMAD IKHSAN SAPUTRO S.T., M.KomPENGEMBANGAN AGEN CERDAS UNTUK PENENTUAN KELAYAKAN PEMBERIAN KREDIT KOPERASI SIMPAN PINJAM697BaruStatus usulan:0314116801AMIK BSI Jakarta034110Penelitian Dosen PemulaKode:ANIK ANDRIANIRANCANG BANGUN SISTEM DETEKSI KEGAGALAN KOPERASI DI TIAP PROVINSI UNTUK MEMBANTU PEMBINAAN KOPERASI698BaruStatus usulan:0303028501AMIK BSI Jakarta034110Penelitian Dosen PemulaKode:KUSUMA HATI S.Kom, M.MKajian Customer Experience Management, Customer Expectation, Customer Relationship Management Terhadap Service Quality Dan Customer Statisfaction Pada Pengguna Jasa PT.KAI Commuter Jabodetabek699BaruStatus usulan:0321037401AMIK BSI Jakarta034110Penelitian Dosen PemulaKode:MUSTIKAWATIFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PERILAKU PEMBERIAN ASI EKSKLUSIF PADA TENAGA KEPERAWATAN DI RUMAH SAKIT WILAYAH TANGERANG SELATAN700BaruStatus usulan:0317047101AKADEMI KEPERAWATAN BERKALA WIDYA HUSADA034187Penelitian Dosen PemulaKode:HENDRAWATIFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN JATUH/INJURY PADA LANSIA DI PSTW BUDI MULIA IV JAKARTA DAN PSTW MELANIA TANGGERANG701BaruStatus usulan:0309066803AKADEMI KEPERAWATAN BERKALA WIDYA HUSADA034187Penelitian Dosen PemulaKode:RESMIATIAnalisa Hubungan Faktor-faktor Yang Mempengaruhi Kadar Gula Darah Pada Pasien Diabetes Mellitus di Rumah Sakit Bhayangkara Tingkat I Sais Sukanto Jakarta 702BaruStatus usulan:0321037902Akademi Keperawatan Andalusia Jakarta034226Penelitian Dosen PemulaKode:FONI AGUS SETIAWANPencarian Rumah Sewa Yang Direkomendasikan Dengan Metode Location Based Service Dan Multiple Attribute Decision Making Berbasis Algoritma Genetika (Studi Kasus: Rumah Sewa Di Sekitar Universitas Ibn Khaldun Bogor)703BaruStatus usulan:0427067701UNIVERSITAS IBN KHALDUN041001Penelitian Dosen PemulaKode:88

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFERIL HARIATI S.T., M.Eng.Aplikasi Sea Level Rise Vulnerability Assessment Model Pada Kawasan Pantai Muara Angke dan Muara Baru, Penjaringan, Jakarta Utara 704BaruStatus usulan:0405047301UNIVERSITAS IBN KHALDUN041001Penelitian Dosen PemulaKode:SYAIFULRoadmap Kebisingan yang Ditimbulkan Kendaraan Bermotor di Kota Bogor705BaruStatus usulan:0420106802UNIVERSITAS IBN KHALDUN041001Penelitian Dosen PemulaKode:- TJUT AWALIYAH ZURAIYAH M.KomPengenalan Karakter Pada Citra Digital Menggunakan Model Jaringan Saraf Tiruan 706BaruStatus usulan:0409017301UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:DWI RINI SOVIA FIRDAUSPengaruh Pola Komunikasi dan Karakteristik Orang Tua dalam Pembentukan Sikap Remaja terhadap Perilaku Tawuran di Kota Bogor707BaruStatus usulan:0304097004UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:ERNI RUSTIANIFormulasi Sediaan Sirup Kombinasi Kelopak Bunga Rosella (Hibiscus sabdariffa L.) dan Herba Seledri (Apium graveolens L.) dengan Berbagai Variasi Jenis Pemanis Sebagai Antihipertensi708BaruStatus usulan:0401037101UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:HAGNI WIJAYANTI S.Si., M.Si.Pendugaan Parameter Model Peningkatan Populasi Perokok dengan Metode Dekomposisi Adomian Multistage709BaruStatus usulan:0412017301UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:MIRA MIRANTI STP.,M.SiFormulasi Food Suplement Granul Instan Berbahan Baku Terong Belanda710BaruStatus usulan:0019106905UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:Dra. BINA LOHITA SARI M.Pd., AptUJI AKTIVITAS ANTIOKSIDAN dan STABILITAS PERMEN JELLY EKSTRAK AIR BUAH KETAPANG (Terminalia catappa Linn.)711BaruStatus usulan:0403086301UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:89

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABOLDSON SITUMORANGPENGENALAN PERANGKAT-PERANGKAT TEKNOLOGI INFORMASI DAN KOMUNIKASI (TIK) BAGI ANAK-ANAK USIA DINI MELALUI APLIKASI PEMBELAJARAN ELEKTRONIK BERBASIS MULTIMEDIA712BaruStatus usulan:0404077905UNIVERSITAS PAKUAN041004Penelitian Dosen PemulaKode:MIRA NURYANTI M.PdPengembangan Model Pembelajaran Berbasis Proyek yang Berorientasi pada Kecerdasan Interpersonal dalam Pembelajaran Sastra pada Siswa Kelas VIII se-Kabupaten Cirebon713BaruStatus usulan:0405077901UNIVERSITAS SWADAYA GUNUNG DJATI041009Penelitian Dosen PemulaKode:IRA RAHAYU S.PdMEMBACA REALITAS SEJARAH INDONESIA DALAM PUISI(Analisis Puisi dengan Pendekatan Mimetik)714BaruStatus usulan:0405028601UNIVERSITAS SWADAYA GUNUNG DJATI041009Penelitian Dosen PemulaKode:MUCHAMAD SUBALI NOTO S.Si., M.pdPengaruh Motivasi dan Aktivitas dalam Pendekatan Pembelajaran Konstruktivisme terhadap Kemampuan Pemahaman dan Penalaran Matematis pada Mata Kuliah Aljabar Linear 1715BaruStatus usulan:0402068603UNIVERSITAS SWADAYA GUNUNG DJATI041009Penelitian Dosen PemulaKode:DODI BUDIROKHMAN SP., MTAPengaruh Pupuk Kandang dan Cendawan Mikoriza Arbuskula (CMA) Terhadap Pertumbuhan dan Hasil Tanaman Bawang Merah (Allium Ascalonicum L)716BaruStatus usulan:0411097304UNIVERSITAS SWADAYA GUNUNG DJATI041009Penelitian Dosen PemulaKode:AGUS SISWANTOKestabilan Tegangan Pada Sistem Distribusi menggunakan Distribution Generation PLTU Biomass 717BaruStatus usulan:0418087903Universitas 17 Agustus 1945 Cirebon041010Penelitian Dosen PemulaKode:EVELYN HEMME TAMBUNANPenggunaan Tehnik Z-Track Air Lock Untuk Menurunkan Rasa Nyeri Pada Saat Prosedur Injeksi Intra Muskuler718BaruStatus usulan:0409127104UNIVERSITAS ADVENT INDONESIA041011Penelitian Dosen PemulaKode:SRI MAYWATI S.KM., M.Kes.Upaya Meningkatkan Ketahanan Pangan (Food Security) Keluarga yang Memiliki Balita Kekurangan Gizi dengan Promosi Konsumsi Makanan Beragam Berbasis Sumber Daya Lokal Melalui Konseling Gizi719BaruStatus usulan:0402077701UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:90

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASITI NOVIANTI M.KM.Faktor Persepsi dan Dukungan Isteri yang Berhubungan dengan Partisipasi KB Pria720BaruStatus usulan:0431058102UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:NUR LINA S.KM., M.Kes (Epid)Analisis Kebiasaan Makan Yang Menyebabkan Peningkatan Kadar Asam Urat Pada Dosen Dan Tenaga Kependidikan721BaruStatus usulan:0415077601UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:ACEP IRHAM GUFRONI S.Kom., M.Eng.Implementasi Executive Information System (EIS) pada Sistem Informasi Penerimaan Bantuan Di Unit Pelayanan Cepat Penanggulangan Kemiskinan (UPCPK) Kabupaten Tasikmalaya722BaruStatus usulan:0414038501UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:NURUL HIRONAPLIKASI DAKWAH DIGITAL BERBASIS MULTIMEDIA DI DOMPET PEDULI UMMAT DAARUT TAUHIID TASIKMALAYA723BaruStatus usulan:0419087504UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:HUSNI MUBAROKImplementasi SMS Gateway Berbasis Web Untuk Layanan Informasi Badan Pemberdayaan Masyarakat dan Keluarga Berencana (BPMKB) Di Kabupaten Tasikmalaya724BaruStatus usulan:0425118101UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:R REZA EL AKBAR S.Si., MT.Aplikasi Pengenalan Unsur-unsur Kimia Berbasis Multimedia untuk Kalangan Dunia Pendidikan dan Industri725BaruStatus usulan:0426078302UNIVERSITAS SILIWANGI041012Penelitian Dosen PemulaKode:ELMA YULIUSPola Aliran Batang Anai di Provinsi Sumatera Barat726BaruStatus usulan:0404098204UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:AGUSTINA EKASARI S.Psi., M.Psi.Kesejahteraan Spiritual dan Ketidaksetiaan Pasangan terhadap Penyesuaian Perceraian Pada Istri di Kota Bekasi727BaruStatus usulan:0420087303UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:91

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAKORI SUNDARIImplementasi Pendidikan Pengurangan Resiko Bencana (PRB) di Sekolah Dasar melalui Model Pembelajaran Picture and Picture pada pelajaran IPS728BaruStatus usulan:0404107203UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.Pd. MIA KUSUMAWATI M.Pd.Analisis anxiety atlet PORDA Kota Bekasi729BaruStatus usulan:0414058501UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.Kom. RETNO NUGROHO WHIDHIASIH M.Kom.Pengembangan Model Identifikasi Tahap Kematangan Manggis Menggunakan Principal Component Analisys (PCA) dan Fuzzy Neural Network (FNN)730BaruStatus usulan:0429037601UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:SARWINARNOANALISIS ALAT PENUKAR KALOR JENIS SHELL AND TUBE PADA EKONOMISER731BaruStatus usulan:0416055902UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.Sos. TATIK YUNIARTI M.I.Kom.Peran Komunikasi Korporat ( Corporate Communication ) Pengembang Kawasan Industri Terhadap Masyarakat Lokal dalam Meredam Konflik Sosial ( Analisis Terhadap Pola dan Model Community Relations PT Jababeka, Tbk dan PT Lippo Cikarang,Tbk di Kabupaten Bekasi732BaruStatus usulan:0426108202UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:EKA MUSTIKAIMPLEMENTASI KURIKULUM 2013 BERBASIS PENDEKATAN SAINTIFIK DALAM PENGEMBANGAN LITERASI SAINS DI SEKOLAH DASAR 733BaruStatus usulan:0420088204UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:Ir. ABDUL HAFID PARONDA MT.Analisis Perbandingan Delay Time(Waktu Tunda)Penyambungan Komunikasi Bergerak Seluler dalam Wilayah Layanan UNISMA Bekasi (Studi Kasus Operator Indosat, Telkomsel, dan Excelcomindo).734BaruStatus usulan:0416036403UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.Si. YOPI HANDOYO M.T.ANALISIS GETARAN TERHADAP PERMUKAAN PISTON MODEL KONTUR RADIUS GELOMBANG SINUS 735BaruStatus usulan:0429068003UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:92

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYUNITA LASMAKontribusi Pola Asuh Orangtua Dan Bimbingan Guru Terhadap Kecerdasan Emosional Anak Usai Sekolah Dasar. (Suatu Studi Deskriptif Analitik Pada Anak Sekolah Dasar Negeri Kelas I Se-Kota Bekasi)736BaruStatus usulan:0416068101UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.T ANDI HASAD M.KomAnalisis dan Optimasi Kinerja Sistem pada Transmisi Data Rate Video Streaming melalui Jaringan Bluetooth Piconet Pervasive737BaruStatus usulan:0323047503UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:Dra. ISTI PUJIHASTUTI M.E.Pengaruh locus of control dan faktor lingkungan terhadap pembentukan karakter wirausaha mahasiswa di wilayah Bekasi738BaruStatus usulan:0009106210UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.T ANITA SETYOWATI SRIE GUNARTI M.T.Atterberg Limit dan Direct Shear Strength Pada Tanah lempung dengan RCC 15 dan Ca(OH)2 739BaruStatus usulan:0404127605UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.Psi. NOVITA DIAN IVA PRESTIANA M.Psi.HUBUNGAN ANTARA KONFLIK PERAN GANDA ISTRI DAN LOCUS OF CONTROL INTERNAL DENGAN KEPUASAN KERJA PADA KARYAWAN WANITA DI UNISMA BEKASI 740BaruStatus usulan:0408088006UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.E. RUSHAM M.MANALISIS DAMPAK KENAIKAN UPAH MINIMUM (UMK) KOTA BEKASI TAHUN 2014 DAN KENAIKAN HARGA BBM TERHADAP KEBERLANGSUNGAN USAHA KELOMPOK INDUSTRI GARMEN741BaruStatus usulan:0420057301UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:Ir. ACHMAD FACHRURROZI MMHUBUNGAN KUALITAS LAYANAN E-KTP TERHADAP KEPUASAN MASYARAKAT DI DESA SETIAMEKAR 742BaruStatus usulan:0405075301UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:S.T SUGENG M.T.SISTEM PERINGATAN DINI DAN TINGKAT BAHAYA KEBAKARAN BERBASIS MIKROKONTROLLER ATMEGA 32 743BaruStatus usulan:0424127501UNIVERSITAS ISLAM 45041018Penelitian Dosen PemulaKode:93

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIRMA PURNAMASARI S.Sos., M.SiModel Peningkatan Kinerja Sumber Daya Aparatur Negara Melalui Sistem Pengadaan Pegawai Berbasis Kompetensi Di Lingkungan Pemerintah Daerah Kota Bogor744BaruStatus usulan:0401077701UNIVERSITAS DJUANDA041019Penelitian Dosen PemulaKode:ANI YUMARNI S.H.I., M.HKesadaran Hukum Masyarakat terhadap Mediasi dalam Perkara Perceraian berdasarkan Perma Nomor 01 Tahun 2008 (Studi Kasus pada Pengadilan Agama Bogor Kelas 1B)745BaruStatus usulan:0428018301UNIVERSITAS DJUANDA041019Penelitian Dosen PemulaKode:RATNA DEWI RAHMAWATIPerlindungan Hak Kekayaan Intelektual Terhadap Peredaran Vcd Bajakan di Kota Bogor746BaruStatus usulan:0420098503UNIVERSITAS DJUANDA041019Penelitian Dosen PemulaKode:YANYAN MULYANINGSIHRESPON PERTUMBUHAN DAN HASIL PADA TANAMAN SAWI MANIS (Brassica juncea L.) AKIBAT DARI PENAMBAHAN DOSIS PUPUK ORGANIK CAIR URIN SAPI DAN PUPUK N, P SERTA K 747BaruStatus usulan:0423037002UNIVERSITAS DJUANDA041019Penelitian Dosen PemulaKode:RASMITADILADESAIN SISTEM PEMBELAJARAN MATAKULIAH PSIKOLOGI PERKEMBANGAN PESERTA DIDIK PADA PROGRAM STUDIS-1 PGSD748BaruStatus usulan:0402057605UNIVERSITAS DJUANDA041019Penelitian Dosen PemulaKode:ABDUL RAHMAN RUSLI S.Hut., M.SiPENDUGAAN CADANGAN KARBONDI ATAS PERMUKAAN TANAHDI HUTAN PENELITIAN DRAMAGA BOGOR749BaruStatus usulan:0408086901UNIVERSITAS NUSA BANGSA041020Penelitian Dosen PemulaKode:Ir. LINAR HUMAIRA MSPERBEDAAN PENDAPATAN PETANI MANGGIS YANG MENJUAL PANENNYA KE IJON vs PETANI MANGGIS YANG MENJUAL PANENNYA KE EKSPORTIR DI KECAMATAN WANAYASA KABUPATEN PURWAKARTA750BaruStatus usulan:0005116402UNIVERSITAS NUSA BANGSA041020Penelitian Dosen PemulaKode:Dra. I GUSTI AYU MANIK WIDHYASTINI M.KesPemanfaatan Colocasia esculenta (L) Schott sebagai Larvasida Nyamuk751BaruStatus usulan:0005086601UNIVERSITAS NUSA BANGSA041020Penelitian Dosen PemulaKode:94

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABAMBANG SUPRIONO S.Hut., M.SiPEMANFAATAN DAN POTENSI SUMBERDAYA AIR DI DESAUJUNG JAYA, KABUPATEN PANDEGLANGPROPINSI BANTEN.752BaruStatus usulan:0420125301UNIVERSITAS NUSA BANGSA041020Penelitian Dosen PemulaKode:TOTO SAPUTRAPRODUKSI POLIFENOL OKSIDASE DARI APEL UNTUK PRODUK MEMBRAN BERBASIS ENZIM PENDETEKSI FENOL 753BaruStatus usulan:0413104901UNIVERSITAS JENDERAL ACHMAD YANI041021MP3EIKode:MOCHAMMAD AZIZ BASARI S.Sos., M.MAnalisis Penerapan Strategi Bauran Promosi (Penelitian di Fakultas Ekonomi Universitas Galuh Ciamis)754BaruStatus usulan:0428087001UNIVERSITAS GALUH CIAMIS041023Penelitian Dosen PemulaKode:H YUSUP ISKANDAR SE.,M.M.Peran Badan Permusyawaratan Desa (BPD) Dalam Mewujudkan AKuntabilitas Alokasi Dana Desa (ADD) (Penelitian Pada Desa-desa di Wilayah Kecamatan Sadananya)755BaruStatus usulan:0419066904UNIVERSITAS GALUH CIAMIS041023Penelitian Dosen PemulaKode:EVA FARIDAH SE.,M.SiAnalisis Peran Audit Operasional Dalam Meningkatkan Efektivitas Pengendalian Intern Penjualan Pada PD. ACB Banjarsari756BaruStatus usulan:0429127002UNIVERSITAS GALUH CIAMIS041023Penelitian Dosen PemulaKode:NILA KRISNAWATI HIDAYAT SE., MMStrategi Pengembangan Kompetensi Sumber Daya Pelaku Industri Kreatif Melalui Pendidikan, Ketrampilan dan Budaya di Tangerang Selatan 757BaruStatus usulan:0428027203UNIVERSITAS SWISS GERMAN041026Penelitian Dosen PemulaKode:IRVAN SETIADI KARTAWIRIA ST., M.Sc.Pemurnian dan Karakterisasi Enzim Alfa Amilase Hasil Fermentasi Sorgum758BaruStatus usulan:0412057602UNIVERSITAS SWISS GERMAN041026Penelitian Dosen PemulaKode:YULLY AMBARSIH EKAWARDHANI M.SnKARAKTER DALAM FILM ANIMASI KARTUN ANAK YANG MENERAPKAN PRINSIP ANTROPOMORFISME DAN PERSONIFIKASI 759BaruStatus usulan:0427076901UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:95


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADENI ALBARKajian Interaksi Visual Game Terhadap Kreativitas Mahasiswa Berkarya Desain768BaruStatus usulan:0421028202UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:SONI MULYAWAN SETIANA S.Pd., M.Pd.Sistem Pengelolaan Sampah di Jepang769BaruStatus usulan:0425027702UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:UTAMI DEWI WIDIANTI S.KomModel Pengelolaan Materi Ajar Pada Portal Knowledge Management SystemStudi Kasus Program Studi Teknik Informatika Unikom770BaruStatus usulan:0414118302UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:PONI SUKAESIH KURNIATI S.IP.M.SiPengaruh Kualitas Pelayanan Terhadap Kepuasan Mahasiswa Universitas Komputer Indonesia (UNIKOM)771BaruStatus usulan:0426107401UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:KANIA EVITA DEWI M.SiIMPLEMENTASI SEMI DISCRETE DECOMPOSITION PADA METODE LATENT SEMANTIC INDEXING UNTUK PENCOCOKAN JAWABAN ESSAY (Studi kasus kuliah online UNIKOM)772BaruStatus usulan:0431088402UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:ARINITA SANDRIA S.H.,M.HumPeranan Kepolisian Negara Republik Indonesia dalam Pencegahan dan Penanganan Penyelundupan Manusia (People Smuggling) Dikaitkan dengan Undang-Undang Nomor 2 Tahun 2002 tentang Kepolisian Negara Republik Indonesia juncto Undang-Undang Nomor 6 Tahun 2011 te773BaruStatus usulan:0428027202UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:DONY WALUYA FIRDAUS S.E.M.SiCepat Tanggap Pemberantasan Penyakit (Penyakit Menular dan Penyakit Tidak Menular) dengan SMS berbasis Sistem Informasi Kesehatan774BaruStatus usulan:0410078101UNIVERSITAS KOMPUTER INDONESIA041027Penelitian Dosen PemulaKode:SARI LAELATUL QODRIAH S.E., M.Si.KESUKSESAN KARIR DOSEN MELALUI : Kepribadian dan Motivasi (Studi pada Perguruan Tinggi Di Wilayah Cirebon)775BaruStatus usulan:0407107401UNIVERSITAS MUHAMMADIYAH CIREBON041029Penelitian Dosen PemulaKode:97

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANUR ASYIAHOPTIMALISASI IMPLEMENTASI PENDIDIKAN KARAKTER PADA “KURIKULUM 2013” MENGGUNAKAN STRATEGI 3M (MORAL KNOWING, MORAL FEELING & MORAL ACTION) DI SEKOLAH DASAR776BaruStatus usulan:0403018901UNIVERSITAS MUHAMMADIYAH CIREBON041029Penelitian Dosen PemulaKode:HADI SUSILOFrekuensi Gen Pengecap Phenylthiocarbamida (PTC) Mahasiswa Suku Sunda Beberapa Fakultas di Lingkungan Universitas Mathla’ul Anwar Pandeglang777BaruStatus usulan:0427067302UNIVERSITAS MATHLA UL ANW AR041032Penelitian Dosen PemulaKode:MU JIJAHIdentifikasi Jenis Khamir Pada Nektarium Bunga Di Hutan Kampus Universitas Mathla’ul Anwar Pandeglang778BaruStatus usulan:0402037005UNIVERSITAS MATHLA UL ANW AR041032Penelitian Dosen PemulaKode:SUWARI AKHMADDHIAN S.H., M.H.Partisipasi Masyarakat dalam mewujudkan Kuningan sebagai Kabupaten Konservasi (Studi di Kabupaten Kuningan)779BaruStatus usulan:0408108104UNIVERSITAS KUNINGAN041038Penelitian Dosen PemulaKode:AI NURLAILAPenggunaan Cendawan Mikoriza arbuskula (CMA) untuk Pertumbuhan Kacang Hijau (Phaseolus radiatus, L.) Pada Tanah Bekas Galian C780BaruStatus usulan:0404117804UNIVERSITAS KUNINGAN041038Penelitian Dosen PemulaKode:NINA HERLINAKearifan Lokal Masyarakat Dalam Pengelolaan Kawasan Hutan Gunung Tilu Kabupaten Kuningan Jawa Barat781BaruStatus usulan:0412047606UNIVERSITAS KUNINGAN041038Penelitian Dosen PemulaKode:R FAJAR SALIM S.S., M.Si.Pelaksanaan Komunikasi Terapeutik oleh Perawat terhadap Pasien Rawat Inap di Badan Layanan Umum Daerah (BLUD) RS Sekarwangi Kabupaten Sukabumi782BaruStatus usulan:0420097202UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:SUHENDAR S.Pd.PENGEMBANGAN MODEL KURIKULUM PENDIDIKAN LINGKUNGAN HIDUP (PLH) SMP DI KOTA SUKABUMI 783BaruStatus usulan:0415018201UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:98


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEUIS KANIA KURNIAWATI S.T., M.T.Uji karakteristik batu pasang sebagai pengganti batu bata untuk bangunan rumah tinggal di kecamatan surade sukabumi selatan792BaruStatus usulan:0429047701UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:ENDANG TRI ASTUTININGSIH S.P., M.P.Pengembangan Manggis sebagai Komoditas Unggulan Lokal Kabupaten Sukabumi793BaruStatus usulan:0402127202UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:DEVI INDAH ANWAR M.Si.Sintesis Polimer Terimpregnasi Fe-TiO2 untuk Fotodegradasi Metilen Blue794BaruStatus usulan:0412108603UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:ERIK CANDRA PERTALA S.S., M.Hum.BAHASA SLANG WIDAL DI KELURAHAN TIPAR KOTA SUKABUMI795BaruStatus usulan:0403077301UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:DYAH VITALOCCA M.Pd.Pemanfataan Aplikasi Sistem Informasi Pemetaan Kompetensi TIK Guru dalam Mengukur Tingkat Kompetensi Pedagogik dan Profesional Guru SMK Bidang Keahlian Teknik Komputer dan Informatika Se-kota Sukabumi796BaruStatus usulan:0412048405UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:DAVID SETIADITEKS PERMAINAN ANAK ORAY-ORAYAN ANALISIS STRUKTUR, KONTEKS PENUTURAN, PROSES PENCIPTAAN, DAN FUNGSI797BaruStatus usulan:0411128501UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:BILLYARDI RAMDHAN S.Pd.Keanekaragaman Tumbuhan dan Etnobotani di Hutan Embah Dalem sebagai Identitas Budaya Kampung Adat Cikodang Dan Lamajang Kabupaten Bandung Provinsi Jawa Barat798BaruStatus usulan:0426068301UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:LELA MUKMILAH YUNINGSIH S.T.DEGRASASI LIMBAH MINYAK SECARA ELEKTRO-OKSIDASIMENGGUNAKAN ELEKTRODA PASTA KARBON DAN PASTA KOBAL799BaruStatus usulan:0411067801UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:100

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAADE SUPARTINI M.Pd.PENGARUH WORKSHOP MENULIS BERBASIS CONFERENCING TERHADAP KEMAMPUAN MENULIS SKRIPSI MAHASISWA PBSI FKIP UMMI800BaruStatus usulan:0413098103UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:SISTIANA WINDYARIANI M.Pd.Pengaruh Strategi Pembelajaran Science Technology Literacy Berbasis Lingkungan terhadap Peningkatan Literasi Sains Calon Guru Sekolah Dasar di Kota Sukabumi801BaruStatus usulan:0407088301UNIVERSITAS MUHAMMADIYAH SUKABUMI041040Penelitian Dosen PemulaKode:JOHAN OSCAR ONGPERANCANGAN LEMARI PAKAIAN BERDASARKAN CUSTOMER VOICE UNTUK MENINGKATKAN DAYA SAING INDUSTRI MEUBEL 802BaruStatus usulan:0421018202UNIVERSITAS PRESIDEN041041Penelitian Dosen PemulaKode:DEFFY SUSANTI S.T., M.Kom.SIMULASI APLIKATIF PEMBUATAN PUPUK ORGANIK CAIR DAN KOMPOS PADA BPLH KABUPATEN MAJALENGKA MENGGUNAKAN MEDIA SOFTWARE MULTIMEDIA 2 DIMENSI ADOBE FLASH CS 4803BaruStatus usulan:0424108402Universitas Majalengka041043Penelitian Dosen PemulaKode:YUDI SAMANTHA S.T., M.T.MODEL PEMBELAJARAN EXPERIENTIAL KOLB DENGAN VISUALISASI VIRTUAL UNTUK MENINGKATKANPEMAHAMAN KONSEP MAHASISWA TEKNIK MESIN PADA MATA KULIAH FISIKA DASAR II MATERI LISTRIK804BaruStatus usulan:0426077701Universitas Majalengka041043Penelitian Dosen PemulaKode:ASEP RACHMAT S.T., M.T.SISTEM PAKAR PENYAKIT MATA DENGAN WML DAN PHPPADA PERANGKAT MOBILE(Studi Kasus Pada Warga Desa Heuleut Kecamatan Kadipaten Kabupaten Majalengka)805BaruStatus usulan:0418087604Universitas Majalengka041043Penelitian Dosen PemulaKode:ENANG RUSNANDIPerencanaan Strategis Cloud Computing Technology Berbasis GAfE (Google Apps for Education) pada Perguruan Tinggi Swasta di Wilayah III Cirebon Propinsi Jawa Barat806BaruStatus usulan:0414067108Universitas Majalengka041043Penelitian Dosen PemulaKode:DONY SUSANDI S.T., M.T.PERANCANGAN DAN PEMBUATAN APLIKASI PENYUSUNAN JADWAL KERJA DINAS JAGA PERAWAT IGD MENGGUNAKAN ALGORITMA TPB(Studi Kasus di RSUD Kabupaten Majalengka)807BaruStatus usulan:0419107803Universitas Majalengka041043Penelitian Dosen PemulaKode:101

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADINAR S.P., M.P.kajian pola kemitraan agribisnis mangga gedong gincu (studi kasus diwilayah tiga cirebon (Kab. majalengka, Kab. Cirebon, Kab. Indramayu808BaruStatus usulan:0417108001Universitas Majalengka041043Penelitian Dosen PemulaKode:HANI SRI MULYANIPENGARUH PROFITABILITAS DAN PERTUMBUHAN PENJUALAN TERHADAP STRUKTUR MODAL(StudiEmpirisPada Perusahaan ManufakturSektorIndustriBarangKonsumsiMakanandanMinuman Yang Terdaftar Di Bursa Efek Indonesia Periode 2008-2012)809BaruStatus usulan:0427098301Universitas Majalengka041043Penelitian Dosen PemulaKode:ERNA GARNIA SE.,MMStudi Pengaruh Likuiditas Saham Terhadap Return Saham di Bursa Efek Indonesia810BaruStatus usulan:0413086401UNIVERSITAS SANGGA BUANA041044Penelitian Dosen PemulaKode:HARIS TRIONO SIGIT S.KomIMPLEMENTASI TEKNOLOGI LOCATION BASED SERVICE DALAM PENENTUAN RUTE TRAVEL GUIDE BERBASIS ANDROID811BaruStatus usulan:0405057711Universitas Serang Raya041049Penelitian Dosen PemulaKode:WYKE KUSMASARI ST., MT.Perancangan Metode Kerja Pekerjaan Konstruksi Bangunan Yang Dapat Meminimalisir Kelelahan dan Resiko Musculoskeletal Disorders812BaruStatus usulan:0403058702Universitas Serang Raya041049Penelitian Dosen PemulaKode:RINA OKTAVIYANTHIIMPLEMENTASI PEMBELAJARAN KALKULUS BERBANTUAN MICROSOFT MATHEMATICS813BaruStatus usulan:0412108506Universitas Serang Raya041049Penelitian Dosen PemulaKode:SULISTIYONO M.Kom.ANALISIS PENDUKUNG KEPUTUSAN PENENTUAN PEMBELIAN BAHAN BAKU UNTUK PEMBUATAN MEUBIL JENIS KURSI LETER L MENGGUNAKAN FUZZY TSUKAMOTO814BaruStatus usulan:0419097202Universitas Serang Raya041049Penelitian Dosen PemulaKode:MUHAMMAD JOHAN WIDIKUSYANTO S.Pd., M.SAnalisis Faktor-Faktor Eksternal yang Mempengaruhi Keberlanjutan Industri Polimer di Indonesia815BaruStatus usulan:0405018101Universitas Serang Raya041049Penelitian Dosen PemulaKode:102

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAKIP SUHENDAR S.Kom.SISTEM IDENTIFIKASI GANGGUAN MATA DENGAN MENGGUNAKAN PENDEKATAN RULE BASED SYSTEM816BaruStatus usulan:0425068401Universitas Serang Raya041049Penelitian Dosen PemulaKode:DEVIYANTORO SE., M.M.ANALISIS KEMAMPUAN KOMUNIKASI INTERPERSONAL PADA WARTAWAN HARIAN LOKAL DI KOTA SERANG IMPLIKASINYA PADA KINERJA817BaruStatus usulan:0429096905Universitas Serang Raya041049Penelitian Dosen PemulaKode:SUMIATI ST., MM.Penerapan Sistem Inferensi Fuzzy Mamdani Untuk Pengaturan Lampu Lalu Lintas818BaruStatus usulan:0402098202Universitas Serang Raya041049Penelitian Dosen PemulaKode:WAHYU OKTRI WIDYARTO ST., MT.PENENTUAN TITIK KRITIS UNIT PRODUKSI BILLET STEEL PLANT (BSP) DENGAN METODE OVERALL EQUIPMENT EFFECTIVENESS (OEE) PADA PT. KRAKATAU STEEL819BaruStatus usulan:0405108401Universitas Serang Raya041049Penelitian Dosen PemulaKode:SYAMSUDIN S.SiMODEL PENINGKATAN PENCAPAIAN MDG’S TAHUN 2015 DI KOTA SERANG820BaruStatus usulan:0411087101Universitas Serang Raya041049Penelitian Dosen PemulaKode:Drs SURYAMAN MMRANCANGAN PENGUKURAN KINERJA DOSEN DENGAN PENDEKATAN BALANCED SCORECARD821BaruStatus usulan:0415056402Universitas Serang Raya041049Penelitian Dosen PemulaKode:NINA ARLOFA S.Si.Karbon Aktif Kulit Durian dengan Aktivator KOH Sebagai Biosorben Logam Fe untuk meningkatkan Kualitas air Tanah822BaruStatus usulan:0425097304Universitas Serang Raya041049Penelitian Dosen PemulaKode:HARSITI ST., M.Kom.PROTOTYPE SISTEM PENDUKUNG KEPUTUSAN PENYELEKSIAN ATLET BERPRESTASI DENGAN MENGGUNAKAN METODE ANALYTICAL HIERARCHY PROCESS (AHP)823BaruStatus usulan:0425087602Universitas Serang Raya041049Penelitian Dosen PemulaKode:103

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAVIDILA ROSALINA S.Kom.Rancang Bangun Sistem Customer Relationship Management (CRM) pada Perusahaan Petrokimia menggunakan Object Oriented Analysis and Design (OOAD)824BaruStatus usulan:0424067702Universitas Serang Raya041049Penelitian Dosen PemulaKode:SHOHIFAH ANNURPenggunaan Adsorben Multilayer dari Bahan Bekas untuk Treatment Air Lindi di TPA Cilowong, Kota Serang825BaruStatus usulan:0406048504Universitas Serang Raya041049Penelitian Dosen PemulaKode:RETNO WULANDARIPembuatan Biosorben Cadmium Dalam Larutan Dengan Pektin Tersaponifikasi Kalsium Hidroksida826BaruStatus usulan:0413038505Universitas Serang Raya041049Penelitian Dosen PemulaKode:YANI SUPRIANIPENGARUH MODEL PEMBELAJARAN CD INTERAKTIF DAN TINGKAT KREATIVITAS MAHASISWA MULTIMEDIA TERHADAP HASIL BELAJAR PADA MATA KULIAH ALJABAR LINIER POKOK BAHASAN MATRIKS827BaruStatus usulan:0408058502Universitas Serang Raya041049Penelitian Dosen PemulaKode:MARLIA PURNAMASARI S.Kom.SISTEM PENDUKUNG KEPUTUSAN PENGKLASIFIKASIAN JENIS KECERDASAN ANAK USIA SEKOLAH DASAR MENGGUNAKAN ALGORITMA C4.5828BaruStatus usulan:0424117902Universitas Serang Raya041049Penelitian Dosen PemulaKode:MULJADI S.Ag., M.M.Operasionalisasi Pemasaran Syari’ah Pada ProdukBaitul Maal Wat Tamwil (BMT) di Provinsi Banten829BaruStatus usulan:0426017205Universitas Muhammadiyah Tangerang041051Penelitian Dosen PemulaKode:HENDY YULIANSYAHPerancangan Media Pembelajaran Aksara Sunda untuk Siswa Sekolah Dasar830BaruStatus usulan:0403077702Universitas BSI041052Penelitian Dosen PemulaKode:DASRUN HIDAYATKOMUNIKASI ANTAR PRIBADI PENYANDANG EPILEPSI DENGAN MASYARAKAT SEKITAR PENYANDANG (Analisis Studi Kasus tentang Pengungkapan Diri dan Kepercayaan dalam Membangun Human Relations Penyandang dengan Masyarakat Sekitar) di Kota Bandung831BaruStatus usulan:0416117802Universitas BSI041052Penelitian Dosen PemulaKode:104

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI HAYATIPengaruh Metode Hypnobirthing dalam Menurunkan Rasa Cemas dan Nyeri Persalinan pada Ibu Bersalin Kala I di Puskesmas Cibiru Hilir - Bandung832BaruStatus usulan:0004047503Universitas BSI041052Penelitian Dosen PemulaKode:OKATIRANTIGambaran Pengetahuan dan sikap perawat dalam pelaksanaan Discharge Planning pada pasien Diabetes Mellitus Type II di rumah sakit pemerintah dan rumah sakit swasta di Kota Bandung(mixed methods)833BaruStatus usulan:0016107501Universitas BSI041052Penelitian Dosen PemulaKode:FADILLA OKTAVIANAEFEKTIVITAS MODEL BELAJAR WHOLE BRAIN LEARNING DALAM PEMBELAJARAN BERBICARA BAHASA INGGRIS (Quasi Eksperimen Pada Mahasiswa Semester 2 Program Studi Pendidikan Bahasa Inggris Universitas Banten Jaya 2013/2014)834BaruStatus usulan:0406108501Universitas Banten Jaya041055Penelitian Dosen PemulaKode:WIKA HARDIKA LEGIANIEFEKTIFITAS PENDIDIKAN KARAKTER PADA MAHASISWA PPKN DALAM MEMBENTUK WARGA NEGARA YANG BAIK (GOOD CITIZENSHIP)835BaruStatus usulan:0420128603Universitas Banten Jaya041055Penelitian Dosen PemulaKode:ARSYAD RAMADHAN DARLIS ST., MT.IMPLEMENTASI SISTEM KOMUNIKASI VIDEO MENGGUNAKAN VISIBLE LIGHT COMMUNICATION (VLC) 836BaruStatus usulan:0401058701INSTITUT TEKNOLOGI NASIONAL042002Penelitian Dosen PemulaKode:JASMAN PARDEDE S.Si., M.T.PERBANDINGAN METODE GVSM DENGAN LSI UNTUK INFORMATION RETRIEVAL DOKUMEN TEKS BAHASA INDONESIA837BaruStatus usulan:0426097801INSTITUT TEKNOLOGI NASIONAL042002Penelitian Dosen PemulaKode:ST. HENDI HANDIAN RACHMAT MT.Pengembangan Pojok Sehat untuk Penderita Tuna Netra berbasis Mikrokontroller838BaruStatus usulan:0417087701INSTITUT TEKNOLOGI NASIONAL042002Penelitian Dosen PemulaKode:ALILA PRAMIYANTIPERILAKU REMAJA DALAM MENGGUNAKAN MEDIA BARU:PEMETAAN HABIT MEDIA BARU REMAJA DAERAH SUB URBAN KOTA BANDUNG (KABUPATEN BANDUNG)839BaruStatus usulan:0425078002Institut Manajemen Telkom042009Penelitian Dosen PemulaKode:105

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASISKA NOVIARISTANTI SSi., MTAnalisis Kemampuan Menulis dalam Bahasa Inggris Karyawan PT Telkom Indonesia Tbk Berdasarkan Tingkat Berpikir Kritis dan Kecerdasan Linguistik840BaruStatus usulan:0310117804Institut Manajemen Telkom042009Penelitian Dosen PemulaKode:RENI MARLINAFeasibility Dari Green Marketing Kelompok Usaha Pengolahan Produk Singkong di Kampung Cirendeu841BaruStatus usulan:0423087507SEKOLAH TINGGI ILMU EKONOMI EKUITAS043022Penelitian Dosen PemulaKode:- RD DANDY TRESNA SOERIAWIBAWA SE, MSIMeningkatkan Loyalitas melalui Customer Perceived Value842BaruStatus usulan:0416046603SEKOLAH TINGGI ILMU EKONOMI STEMBI043026Penelitian Dosen PemulaKode:- AI ROHAYATI SEPENGUJIAN DAMPAK ORGANIZATIONAL CITIZENSHIP BEHAVIOR (OCB) PADA KEPUASAN KERJA GURU HONORER DI KOTA BANDUNG 843BaruStatus usulan:0420098402SEKOLAH TINGGI ILMU EKONOMI STEMBI043026Penelitian Dosen PemulaKode:DEASY ADITYA DAMAYANTIImplementasi Gerakan Menulis “Sastra Hijau” di Lingkungan SMA/ SMK Kabupaten Garut, Suatu Refleksi Pendidikan Bahasa dan Sastra Berbasis Sains844BaruStatus usulan:0414038901STKIP GARUT043030Penelitian Dosen PemulaKode:ARI KARTINIKARAKTERISTIK BERBAHASA SANTUN DALAM PERSPEKTIF KEBUDAYAAN SUNDA SEBAGAI ALTERNATIF PENGEMBANGAN BAHAN AJAR MATA KULIAH SOSIOLINGUISTIK845BaruStatus usulan:0408038801STKIP GARUT043030Penelitian Dosen PemulaKode:DIAR VENI RAHAYUUPAYA MENINGKATKAN KEMAMPUAN PEMECAHAN MASALAH MATEMATIK SISWA MELALUI MODEL PEMBELAJARAN PELANGI MATEMATIKA846BaruStatus usulan:0403078702STKIP GARUT043030Penelitian Dosen PemulaKode:M. AFRILIANTOStrategi Thinking Aloud Pair Problem Solving untuk Meningkatkan Kemampuan Kelancaran Berprosedur dan Kompetensi Strategis Matematis Siswa SMP847BaruStatus usulan:0429048602STKIP SILIWANGI043041Penelitian Dosen PemulaKode:106

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHAMIDAHMengembangkan Kemampuan Berpikir Tingkat Tinggi Matematis dan Retensinya serta Kemandirian Belajar Siswa SMP Melalui Pendekatan Kontekstual848BaruStatus usulan:0428058703STKIP SILIWANGI043041Penelitian Dosen PemulaKode:Drs. BUNYAMIN M.Kom Pengembangan sistem pakar untuk diagnosis penyakit tanaman padi849BaruStatus usulan:0417106401SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:KIKI AISYAHPerancangan sistem informasi presensi pegawai memanfaatkan teknologi fingerprint850BaruStatus usulan:0405098103SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:Drs. EKO RETNADI M.KomPengembangan Sistem informasi administrasi kependudukan pada bagian pendaftaran pindah datang penduduk851BaruStatus usulan:0410086401SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:DEWI TRESNAWATIPerancangan sistem informasi transaksi tabungan bank sampah Garut852BaruStatus usulan:0428127703SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:PARTONOSistem Pendukung Keputusan Penentuan Persediaan Barang dengan menggunakan metode DSS dan Waterfall853BaruStatus usulan:0414086203SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:ASEP SETIA M.Ag.Pembangunan sistem pakar perhitungan waris islam854BaruStatus usulan:0411057001SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:SE. RINA KURNIAWATI M.Si.PERANCANGAN PROGRAM APLIKASI TRANSAKSI PEMBAYARAN SPP, UTS DAN UASMENGGUNAKAN METODE ANALISIS DAN DESAIN BERORIENTASI OBJEK MODEL UNIFIED APPROACH (UA)855BaruStatus usulan:0420067402SEKOLAH TINGGI TEKNOLOGI GARUT043051Penelitian Dosen PemulaKode:107

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASE DENI RUSTANDI MMPenerapan Model Vestibule Training Dalam Meningkatkan Kemampuan Teknis(Technical Skills) Pengrajin Sangkar Burung Studi Pada Koperasi Unit Desa (KUD) MANDIRI CIKONDANG Kecamatan Selaawi Kabupaten Garut Provinsi Jawa Barat 856BaruStatus usulan:0410037601SEKOLAH TINGGI ILMU EKONOMI YASA ANGGANA043074Penelitian Dosen PemulaKode:DADANG SYAFARUDIN SE., MMPenerapan Konsep Model Pemasaran Online Produk Teh Hijau Dalam Upaya Meningkatan Daya Saing ( Penerapan Model Pada PKBM Sadina Cilawu Garut )857BaruStatus usulan:0430017803SEKOLAH TINGGI ILMU EKONOMI YASA ANGGANA043074Penelitian Dosen PemulaKode:ENCEP ABDUL MADJIDPengaruh Chronotype dan Waktu Belajar Mahasiswa STT Cipasung Terhadap Prestasi Belajar858BaruStatus usulan:0407096301SEKOLAH TINGGI TEKNOLOGI CIPASUNG043100Penelitian Dosen PemulaKode:LINA ERNITAOptimaslisasi Penggunaan Teknologi Biopori dengan Metode Simulasi untuk Upaya Pencegahan Genangan Air Hujan859BaruStatus usulan:0428037404SEKOLAH TINGGI TEKNOLOGI CIPASUNG043100Penelitian Dosen PemulaKode:AHMAD ZAMAKHSYARI SIDIQPembuatan Aplikasi Beban Kerja Fisik dan Mental dengan memanfaatkan Teknologi Multimedia860BaruStatus usulan:0408128601SEKOLAH TINGGI TEKNOLOGI CIPASUNG043100Penelitian Dosen PemulaKode:DEDEN INDRA DINATA M.Si,AptPENGARUH PENAMBAHAN GRANUL EKSTRAK ETANOL DAUN KEMANGI (OCIMUMBASILICUM L.) SEBAGAI ANTIOKSIDAN PENCEGAH RADIKAL BEBAS PADA MAKANAN YANG DIGORENG861BaruStatus usulan:0417097602SEKOLAH TINGGI FARMASI BANDUNG043115Penelitian Dosen PemulaKode:. LIA MARLIANI M.Si., Apt.PENETAPAN KADAR FENOL TOTAL DAN AKTIVITAS ANTIOKSIDAN BUAH DAN DAUN JAMBLANG (Syzigium cumini L.)862BaruStatus usulan:0007128001SEKOLAH TINGGI FARMASI BANDUNG043115Penelitian Dosen PemulaKode:- ANDRI SUKMAINDRAYANA STPERANCANGAN ARSITEKTUR SISTEM INFORMASIPENDUKUNG KEPUTUSAN PENILAIAN KINERJA DOSENDENGAN METODE PROMETHEE(STUDI KASUS : STMIK DCI TASIKMALAYA)863BaruStatus usulan:0428027801STMIK DCI043118Penelitian Dosen PemulaKode:108

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMagister SARMIDI KomputerSMS DIGITAL RT 02 RW01 Kampung Tanjung Sari Kelurahan Sukanegara Kecamatan Purbaratu Kota Tasikmalaya864BaruStatus usulan:0408057201STMIK DCI043118Penelitian Dosen PemulaKode:DADANG HARYANTOModa Transfortasi Terintegrasi dan kemudahan kredit kendaraan bermotor serta Pengaruhnya terhadap kemacetan jalan di jam sekolah ( suatu kajian terhadap SMA AL MUTAQIN )865BaruStatus usulan:0408056601STMIK DCI043118Penelitian Dosen PemulaKode:ARIS MARTONO S.Kom, MMSIMaraknya Transaksi Bisnis Prostitusi Melalui Media Sosial (Human Trafficking In Social Media) Ditinjau Dari Undang-Undang Nomor 21 Tahun 2007 Tentang Pemberantasan Tindak Pidana Perdagangan Orang Dan Undang-Undang Nomor 11 Tahun 2008 Tentang Inform866BaruStatus usulan:0323036002STMIK RAHARJA043175Penelitian Dosen PemulaKode:DEBI TRISTIYANTIPembuatan Nanoemulsi yang mengandung Natrium Askorbil Fosfat sebagai Antiaging 867BaruStatus usulan:0422038002SEKOLAH TINGGI FARMASI INDONESIA043191Penelitian Dosen PemulaKode:Ir. SANTA LUSIANNA SITORUS MM.Evaluasi Sistem Pendidikan STIE Insan Pembangunan Tangerang dalam Meningkatkan Profesionalisme dan Ketrampilan kerja868BaruStatus usulan:0419066802SEKOLAH TINGGI ILMU EKONOMI INSAN PEMBANGUNAN043193Penelitian Dosen PemulaKode:NUR INTAN HAYATI HUSNUL K S.Kep., Ners., PENGARUH TEHNIK DISTRAKSI DAN RELAKSASI TERHADAP TINGKAT NYERI PADA PASIEN POST OPERASI DI RUMAH SAKIT IMMANUEL BANDUNG 869BaruStatus usulan:0414048003SEKOLAH TINGGI ILMU KESEHATAN IMMANUEL BANDUNG043205Penelitian Dosen PemulaKode:- OD SARININGSIH S.STPerbandingan Program Outreach Pada Klinik Voluntary Counseling And Testing (Vct) Negeri Dan Swasta Di Kota Bandung 870BaruStatus usulan:0427047404SEKOLAH TINGGI ILMU KESEHATAN IMMANUEL BANDUNG043205Penelitian Dosen PemulaKode:LILY YULAIKHAH S.Si.T., M.Keb.ANALISIS FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEMATIAN IBU AKIBAT PRE EKLAMSIA / EKLAMSIA DI KABUPATEN INDRAMAYU TAHUN 2013871BaruStatus usulan:0412038201SEKOLAH TINGGI ILMU KESEHATAN INDRAMAYU043213Penelitian Dosen PemulaKode:109


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERICK KHRISTIAN S.Si.PENGUKURAN IMPEDANSI UNTUK PENENTUAN KUANTITAS ANTIBODY PADA UJI WIDAL BERBASIS AD5933 EVAL880BaruStatus usulan:0405038103SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:OOP ROPEI M.Kep.,Ns.Sp.Kep.Kom.EFEKTIFITAS MODEL KELOMPOK SWABANTU UNTUK MENGURANGI BEBAN KELUARGA MERAWAT SEBAGAI UPAYA MENINGKATKAN KUALITAS HIDUP LANJUT USIA DI MASYARAKAT WILAYAH KOTA CIMAHI881BaruStatus usulan:0410087301SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:DYNA APRIANY S.Kp., M.Kep.Pengaruh Oral Care terhadap Pencegahan Terjadinya Oral Mukositis Akibat Kemoterapi pada Anak dengan Kanker di RS Hasan Sadikin Bandung882BaruStatus usulan:0323048002SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:SITTI ROMLAH S.Si.Optimasi PCR Nested untuk amplifikasi gen X virus hepatitis B883BaruStatus usulan:0410097507SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:IQBAL PRAMUKTI S.Kep.,Ners.Pemberdayaan Keluarga Dalam Upaya meningkatkan Praktik Pemberian ASI eksklusif di wilayah binaan Puskesmas Cigugur Tengah Cimahi 2013884BaruStatus usulan:0414088101SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:NUNUNG NURJANAH S.Kp.,M.KepPengaruh Stimulasi Terstruktur Terhadap Perkembangan Anak Usia Pra Sekolah Di Rumah Bintang Islamic Pre School Kota Bandung885BaruStatus usulan:0022027901SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:ACHMAD SETYA ROSWENDI S.Kp.,M.P.H.Pengaruh Hypnotheraphy Terhadap Tingkat Nyeri pada Lansia yang Mengalami Rhematoid Arthritis di Panti Wredha Kabupaten Bandung886BaruStatus usulan:0626107002SEKOLAH TINGGI ILMU KESEHATAN JENDERAL ACHMAD YANI043219Penelitian Dosen PemulaKode:Dra. YENI FIRMAWATI MM.PEMBERDAYAAN KETERAMPILAN IBU RUMAH TANGGA DAN PENDAPATAN KELUARGA DI KELURAHAN BUNDER KECAMATAN CIKUPA KABUPATEN TANGERANG887BaruStatus usulan:0429026801STMIK INSAN PEMBANGUNAN043225Penelitian Dosen PemulaKode:111


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATONI FATULLAHANALISIS USAHA PROSUKSI AYAM TERNAK PEDAGINGDI KECEAMATAN CURUG SERANG-BANTEN896BaruStatus usulan:0409026801SEKOLAH TINGGI ILMU EKONOMI BANTEN043266Penelitian Dosen PemulaKode:SUWIRO HERIYANTOPENGEMBANGAN KAWASAN OBYEK WISATA PANTAI SAWARNA KABUPATEN LEBAK897BaruStatus usulan:0414116502SEKOLAH TINGGI ILMU EKONOMI BANTEN043266Penelitian Dosen PemulaKode:GULI SE., MMANALISIS FAKTOR FINANSIAL, NONFINANSIAL, DAN KONDISI EKONOMI TERHDAP KEBERHASILAN USAHA BUDIDAYA LELE DUMBO DI KECAMATAN BAROS PROVINSI BANTEN898BaruStatus usulan:0415066703SEKOLAH TINGGI ILMU EKONOMI BANTEN043266Penelitian Dosen PemulaKode:ADE SITI MAEMUNAHFaktor risiko HIV pada anak usia 2-5 tahun dengan ibu penderita HIV positif di Provinsi D.I. Yogyakarta899BaruStatus usulan:0030085507SEKOLAH TINGGI ILMU KESEHATAN KUNINGAN GARAWANGI043288Penelitian Dosen PemulaKode:WIRUMA TITIAN ADIPengklasifikasian Cerita Rakyat Di Pulau Jawa Dalam Pengembangan Pendidikan Karakter (Sebuah Analisis Implikatur) 900BaruStatus usulan:0321097502Sekolah Tinggi Ilmu Bahasa Asing Nusa Mandiri043300Penelitian Dosen PemulaKode:WINI HADIYANIPenerapan Model Tungku (Hearth) dalam Modifikasi Diet Pada Balita dengan Malnutrisi di Wilayah Kerja Puskesmas Cimenyan Kabupaten Bandung901BaruStatus usulan:0431017702Sekolah Tinggi Ilmu Keperawatan PPNI Jawa Barat043315Penelitian Dosen PemulaKode:RULLY CHARITAS INDRA PRAHMANAPenyebab Kecemasan Matematika Mahasiswa Calon Guru Asal Papua902BaruStatus usulan:0424018701STKIP Surya043321Penelitian Dosen PemulaKode:FAJAR CIPTANDIPemanfaatan Limbah Karung Goni Melalui Eksperimen Single Yarn dan Tenun ATBM sebagai Alternatif Bahan Baku Tekstil untuk Produk Kerajinan.903BaruStatus usulan:0406128602STISI TELKOM043324Penelitian Dosen PemulaKode:113

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADADAN SUDIANAKajian Rupa Lambang Macan Ali Kesultanan Cirebon904BaruStatus usulan:0424117506STISI TELKOM043324Penelitian Dosen PemulaKode:KIKI RIZKY SOETISNA PUTRIPemetaan Seniman Bandung Berdasarkan pada Proses Kreasi dalam Paradigma Seni Rupa Kontemporer sebagai Materi Penyusunan Bahan Ajar Mata Kuliah Metoda Penciptaan Seni905BaruStatus usulan:0422038501STISI TELKOM043324Penelitian Dosen PemulaKode:ARINI ARUMSARIAnalisa Trend Contemporary Jewelry sebagai Akibat dari Dinamika Perubahan Gaya Hidup Masyarakat dan Perkembangan Industri Fashion906BaruStatus usulan:0404048502STISI TELKOM043324Penelitian Dosen PemulaKode:DIDIT ENDRIAWANMenggali Nilai-Nilai Spiritualitas dalam Karya-Karya Seni Rupa Indonesia (Studi kasus:Karya-karya Amrizal Salayan)907BaruStatus usulan:0415118103STISI TELKOM043324Penelitian Dosen PemulaKode:RACHMANTO HADIPUTRANTOPerancangan dan Pembuatan Dinamometer Tipe Prony Brake Untuk Sarana Praktikum Prestasi Mesin908BaruStatus usulan:0407126904Sekolah Tinggi Teknologi YBS Internasional043325Penelitian Dosen PemulaKode:Ir ERWAN YANI M.MPERANCANGAN ARSITEKTUR UNTUK PENDUKUNG PENGAMBILAN KEPUTUSAN PEMILIHAN PROGRAM STUDI PERGURUAN TINGGI MENGGUNAKAN DIFFERENTIAL APTITUDE TEST (DAT)909BaruStatus usulan:0417116502Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:EFI SOFIAH SE, M.PdAnalisis Sistem Informasi Pembelajaran Akuntansi menggunakan Bahasa pemrograman Borland Delphi 7.0 Berbasis LAN Di Sekolah Menengah Kejuruan910BaruStatus usulan:0427126801Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:Drs. YANA SETIAWAN M.M.Perancangan Sistem Informasi Perijinan Lalu Lintas pada Dinas Perhubungan Kabupaten Garut 911BaruStatus usulan:0410116502Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:114

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMACECEP FURQON STAplikasi Mobile Learning (m-learning) untuk Mata Kuliah Pengantar Teknologi Informasi berbasis Java 2 Micro Edition (J2ME)912BaruStatus usulan:0415027205Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:TEDI BUDIMAN S.Si., M.Kom.Model Pendokumentasian Kegiatan Belajar di Sekolah Menengah Atas Berbasis Teknologi Komputer913BaruStatus usulan:0410067601Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:DEDE KURNIADI S.Kom., M.KomPROTOTIPE PERANGKAT LUNAK SISTEM KENDALI PERALATAN ELEKTRONIK BERBASIS KOMPUTER914BaruStatus usulan:0402098301Akademi Manajemen Informatika Dan Komputer Garut044064Penelitian Dosen PemulaKode:DADANG DARMAWAN SKM.,M.KesPengaruh Motivasi Terhadap Pelaksanaan Diet Hipertensi di Poliklinik Penyakit Dalam RS. Rajawali Bandung 915BaruStatus usulan:0410077204AKADEMI KEPERAWATAN RS DUSTIRA044154Penelitian Dosen PemulaKode:SEPTIAN ANDRIYANIPengaruh pendidikan kesehatan terhadap pengetahuan ibu tentang toilet training pada anak di TK At-Taqwa Cimahi916BaruStatus usulan:0314098002AKADEMI KEPERAWATAN RS DUSTIRA044154Penelitian Dosen PemulaKode:MAXSI ARYMENENTUKAN PROBABILITAS QUALITAS LULUSAN PROGRAM STUDI MENGGUNAKAN LOGISTIC REGRESSION917BaruStatus usulan:0423078301AMIK BSI Bandung044162Penelitian Dosen PemulaKode:ASEP HERMAN S.Th.IPEMANFAATAN TEKNOLOGI INTERNET SEBAGAI MEDIA PROMOSI DALAM UPAYA MENINGKATKAN JUMLAH PENGUNJUNG WISATA EDUKASI MUSEUM KOTA BANDUNG918BaruStatus usulan:0412027705AMIK BSI Bandung044162Penelitian Dosen PemulaKode:ANTONPEMANFAATAN TEKNOLOGI CLOUD COMPUTING UNTUK PENINGKATAN PROSES BELAJAR MENGAJAR919BaruStatus usulan:0316047502AMIK BSI Tangerang044164Penelitian Dosen PemulaKode:115


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWIDIYA AVIANTI S.T., M.M.SOLUSI DAMPAK SOSIAL EKONOMI PEDAGANG PEDESTRIAN(TEMPAT PEJALAN KAKI) DI KOTA BANDUNG)928BaruStatus usulan:0407098001POLITEKNIK LP3I BANDUNG045013Penelitian Dosen PemulaKode:IIN KURNIAWATI S.Pd., M.Si.TINJAUAN PEMBENTUKAN JIWA KEPEMIMPINAN BERKARAKTER ISLAMI(STUDI KASUS PADA MAHASISWA POLITEKNIK LP3I BANDUNG)929BaruStatus usulan:0419037303POLITEKNIK LP3I BANDUNG045013Penelitian Dosen PemulaKode:HENNY UTARSIH S.E.,M.Si.PENGARUH KUALITAS PELAYANAN DAN KEPUASAN TERHADAP LOYALITAS MAHASISWA PENGGUNA JASA PENDIDIKAN POLITEKNIK LP3I BANDUNG 930BaruStatus usulan:0409056504POLITEKNIK LP3I BANDUNG045013Penelitian Dosen PemulaKode:HADIANSYAH MA SUM S.Pd., M.KomPEMANFAATAN ICT DALAM MENINGKATKAN EFISIENSI SUMBER DAYA DI POLITEKNIK LP3I BANDUNG931BaruStatus usulan:0412058005POLITEKNIK LP3I BANDUNG045013Penelitian Dosen PemulaKode:JAJANG BURHANUDINSTRATEGI PEMASARAN DALAM MENINGKATKAN DAYA TARIK WISATA BELANJA KOTA GARUT932BaruStatus usulan:0417026705POLITEKNIK LP3I BANDUNG045013Penelitian Dosen PemulaKode:PRAJNA DESHANTA IBNUGRAHAOptimasi Layanan Hosting untuk Menunjang Kegiatan UKMdi Lingkungan TASS Telkom University933BaruStatus usulan:0412128401POLITEKNIK TELKOM045035Penelitian Dosen PemulaKode:DUDI SOEGIARTO2 Km Ground Control Range for UAV in Disaster Recovery934BaruStatus usulan:0408127104POLITEKNIK TELKOM045035Penelitian Dosen PemulaKode:NELSI WISNA SE, MSiPengaruh Teknologi Informasi dan Budaya Organisasi Terhadap Kualitas Sistem Informasi Akuntansi dan Dampaknya Terhadap Kualitas Informasi Akuntansi (Survey pada Perguruan Tinggi di Kota Bandung)935BaruStatus usulan:0422087102POLITEKNIK TELKOM045035Penelitian Dosen PemulaKode:117


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEMIN HARISVARIASI PUTARAN DAN PRE HEATING CETAKAN TERHADAP SIFAT FISIS DAN MEKANIS BAHAN VELG SEPEDA MOTOR DENGAN METODE CENTRIFUGAL CASTING 944BaruStatus usulan:0405058205Politeknik Indramayu045038Penelitian Dosen PemulaKode:DEDI SUWANDIVISIBLE LIGHT MASKLESS PHOTOLITHOGRAPHY PADA TEMBAGA MENGGUNAKAN CAIRAN ECHING FERRI CHLORIDE (FeCl3)945BaruStatus usulan:0405058401Politeknik Indramayu045038Penelitian Dosen PemulaKode:YUDHY KURNIAWANRANCANG BANGUN DEHUMIDIFIER PORTABLE BEBASIS TERMOELEKTRIK DENGAN VARIASI SUPLAI UDARA MASUKAN946BaruStatus usulan:0411107703Politeknik Indramayu045038Penelitian Dosen PemulaKode:MUHAMMAD LUKMAN SIFASTUDI PERFORMANCE FREERTOS DAN UCLINUX KERNEL PADA PROCESSOR MICRO BLAZE BERBASIS FPGA SPARTAN947BaruStatus usulan:0419056503Politeknik Indramayu045038Penelitian Dosen PemulaKode:KUSNANDARKAJIAN EKSPERIMEN PADA HEAT PUMP MENGGUNAKAN REFRIJERAN PROPANE948BaruStatus usulan:0426057702Politeknik Indramayu045038Penelitian Dosen PemulaKode:MOHAMMAD YANIAnalisis Kendala dalam Perancangan Ontologi Menuju Web Berbasis Semantik (Studi Kasus: Sistem Informasi Akademik Politeknik Indramyu)949BaruStatus usulan:0407038004Politeknik Indramayu045038Penelitian Dosen PemulaKode:IMAM MAOLANA S.T.,M.T.RANCANG BANGUN VIBRATION TEST BENCH UNTUK MENDETEKSI UNBALANCE950BaruStatus usulan:0412118401Politeknik Indramayu045038Penelitian Dosen PemulaKode:Drs ARIS MUNANDAR M.PdUpaya Meningkatkan Kemampuan Pedagogik Guru Sekolah Dasar (SD) Tahunan Yogyakarta Dalam Menyusun RPP Berdasarkan Standar Proses Berbasis Kurikulum 2013 Melalui Pendekatan Collaborative.951BaruStatus usulan:0516054901UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:119

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASAMSUL HADIPARTISIPASI INDUSTRI OTOMOTIF DALAM MENJALIN KERJASAMA DENGAN SEKOLAH MENENGAH KEJURUAN (SMK) PROGRAM KEAHLIAN TEKNIK KENDARAAN RINGAN DI DAERAH ISTIMEWA YOGYAKARTA952BaruStatus usulan:0007017501UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:JAJUK HERAWATIKEPERCAYAAN, KOMITMEN PADA KELOMPOK, KOMUNIKASI DAN PERILAKU KEWIRAORGANISASIAN MENGHADAPI PERSAINGAN BISNIS DIKALANGAN PENGUSAHA BATIK DI YOGYAKARTA953BaruStatus usulan:0510105502UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:Drs. MUJINO M.M.Pengaruh Partisipasi Anggota Koperasi Terhadap Rentabilitas Ekonomi di Kabupaten Bantul, DIY954BaruStatus usulan:0510115501UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:KRISTI WARDHANI M.PDIMPLEMENTASI PENDIDIKAN KARAKTER MELALUI PENGELOLAAN MODAL SOSIAL PADA PEMBELAJARAN DI SEKOLAH DASAR NEGERI TAJI PRAMBANAN955BaruStatus usulan:0317057703UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:SITI SUMARTIYAHImplementasi Undang Undang Nomor. 17 Tahun 2012 jo Undang Undang Nomor. 25 Tahun 1992 tentang Perkoperasian di Kota Yogyakarta956BaruStatus usulan:0513055001UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:SUPENI ENDAHJATIPENGARUH ISLAMIC GOVERNANCE TERHADAP TINGKAT PENGUNGKAPAN CORPORATE SOCIAL RESPONSIBILITY DAN NILAI PERUSAHAAN BANK SYARIAH DI INDONESIA957BaruStatus usulan:0011055101UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:SLAMET PRIYANTOPengembangan Website Materi Alat Ukur Melalui Pembelajaran Blended Learning Untuk Meningkatkan Prestasi Belajar Siswa Kelas X Smk Pondok Pesantren Diponegoro Sleman958BaruStatus usulan:0010065601UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:Dra. DIAH LESTARI MUMPUNI M.M.Dampak Konvergensi International Financial Reporting Standard (IFRS) dan Mekanisme Corporate Governance pada Earnings Persistence dan Manajemen Laba959BaruStatus usulan:0018115301UNIVERSITAS SARJANAWIYATA TAMANSISW A051002Penelitian Dosen PemulaKode:120

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI GATI HUTOMO S.T., M.TStudi Karakteristik Dekomposisi Termal Temperatur Tinggi Ban Bekas Untuk Mendapatkan Bahan Bakar Gas Alternatif960BaruStatus usulan:0509096701UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:Dra. KARTINAH M.SiPeranan Struktur Tatakelola Perusahaan Terhadap Hubungan Kualitas Auditor Independen Dengan Perilaku Oportunistik Managemen961BaruStatus usulan:0524066401UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:HANDOKO ARWI HASTOROPublic Governance dan Kinerja Keuangan Pemerintah Daerah di Indonesia962BaruStatus usulan:0526087501UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:DANANG SUNYOTO S.E., S.H., M.MKualitas Strategi Bersaing Guna Meningkatkan Kinerja Perusahaan Pada UKM dan Koperasi Gerabah Kasongan Bantul963BaruStatus usulan:0518126801UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:UNTORO BUDI SURONO ST., M.Eng.Perancangan dan Uji Coba Alat Pengolah Sampah Plastik Menjadi Bahan Bakar Minyak Tipe Kontinyu 964BaruStatus usulan:0022037101UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:EKO NURHARYANTOPemanfaatan Sistem Inventarisasi, Dokumentasi dan Publikasi Dalam Mengupayakan Perlindungan Budaya Lokal Masyarakat Setempat Dari Klaim Negara Lain965BaruStatus usulan:0503056201UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:FERRI KUSWANTORODampak Inovasi Informasi dan Koordinasi Terhadap Kinerja Kemitraan dan Kinerja Usaha : Studi Usaha Kecil dan Menengah di Kota Madya Yogyakarta966BaruStatus usulan:0512027402UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:FATSYAHRINA FITRIASTUTI S.Si.,M.TPengembangan Multimedia Interaktif Untuk Pembelajaran Mata Kuliah Jaringan Komputer Berbasis Android967BaruStatus usulan:0503107503UNIVERSITAS JANABADRA051003Penelitian Dosen PemulaKode:121

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADra. ENY SULISTYOWATI M.M.ANALISIS PENGARUH KUALITAS PELAYANAN BADAN PERTANAHAN NASIONAL (BPN) TERHADAP KEPUASAN MASYARAKAT DI DAERAH ISTIMEWA YOGYAKARTA 968BaruStatus usulan:0501016501UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:DJOKO WIJONO S.E., M.M.TINGKAT KEPUASAN PENGUNJUNG OBYEK WISATA PANTAI KUWARU SANDEN BANTUL YOGYAKARTA969BaruStatus usulan:0502056601UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:JEMADI S.E., M.M.STRATEGI KELOMPOK BURUH PEREMPUAN DALAM MEMANFAATKAN MODAL SOSIAL UNTUK MENINGKATKAN AKSESIBILITAS PASAR (Studi di Kelompok Buruh Perempuan “Tani Rejo” dalam mengakses Industri Emping Melinjo di Kecamatan Limpung, Kabupaten Batang, Provinsi Jawa Tengah)970BaruStatus usulan:0520096301UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:DWI KUNCAHYO S.H., M.H.PEMBEBANAN HAK TANGGUNGAN YANG DIDAHULUI SURAT KUASA MEMBEBANKAN HAK TANGGUNGAN (SKMHT) DI KANTOR PERTANAHAN KABUPATEN/KOTA DI WILAYAH DAERAH ISTIWEWA YOGYAKARTA 971BaruStatus usulan:0529045701UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:HB SUKARJO S.T., M.Eng.Studi pengaruh suhu proses dan Jenis bahan terhadap rendemen dan nilai kalor bio-oil hasil pirolisis sampah organik972BaruStatus usulan:0530086101UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:YULI KURNIYATI S.E., M.M.ANALISIS KINERJA KELOMPOK PENERIMA PROGRAM DANA BANTUAN MODAL DALAM RANGKA PEMBERDAYAAN EKONOMI BERBASIS KEWILAYAHAN DINAS PERINDAGKOPTAN KOTA YOGYAKARTA.973BaruStatus usulan:0504077101UNIVERSITAS PROKLAMASI 45051004Penelitian Dosen PemulaKode:RR EKO GIYARTININGRUM Pengujian Model Computer-Midiated Communication Competence (CMC Competence) pada Komunitas Pengguna Teknologi Informasi 974BaruStatus usulan:0519067302UNIVERSITAS COKROAMINOTO051006Penelitian Dosen PemulaKode:KRISTIANA SRI UTAMI SE., MM.Strategi Pengembangan Industri Kecil Kreatif Tenun Lurik ATBM di Kabupaten Sleman975BaruStatus usulan:0504087501UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:122

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAPAHARIZAL S.Sos., M.APEMBERDAYAAN MASYARAKAT BERBASIS PENGOLAHAN BAMBU DI KECAMATAN MINGGIR, KABUPATEN SLEMAN YOGYAKARTA976BaruStatus usulan:0517087804UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:JOKO TRI NUGRAHA S.Sos., M.Si.Mewujudkan Good Governance Melalui Pelayanan Publik Berbasis e-Government di Kabupaten Sleman977BaruStatus usulan:0509068102UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:NANY NOOR KURNIYATI SE., M.M.DAMPAK KERENTANAN SOSIAL PADA STRATEGI LIVELIHOODS RUMAH TANGGA PEREMPUAN PESERTA UPPKS DI KECAMATAN NGAMPILAN KOTA YOGYAKARTA 978BaruStatus usulan:0526046802UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:ILMARDANI RINCE RAMLIPenentuan Jenis dan Ketebalan Lapisan Bahan Penyekat Panas Dalam Pembuatan Prototype Canting Elektrik “CANTRIK” 979BaruStatus usulan:0509106201UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:Ir. TRI YUNIASTUTI MT.MENGUNGKAP SEJARAH ARSITEKTURAL DALEM MANGKUBUMEN YOGYAKARTA PERIODE TAHUN 1874- 1949980BaruStatus usulan:0003066402UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:Drs. SUPRIYANTA MM.kinerja merger dan akuisisi pada perusahaan go public981BaruStatus usulan:0525076301UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:MASRUL INDRAYANA S.T., M.T.PEMODELAN PERDAGANGAN DUNIA MAYA PRODUK UMKM DI DAERAH ISTIMEWA YOGYAKARTA982BaruStatus usulan:0531077601UNIVERSITAS WIDYA MATARAM051008Penelitian Dosen PemulaKode:PUTRIANA KRISTANTIAnalisis Pendapatan dan Biaya, serta Proyeksi Tingkat Keuntungan Bertani Padi Organik983BaruStatus usulan:0515056201UNIVERSITAS KRISTEN DUTA WACANA051011Penelitian Dosen PemulaKode:123

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWAHYU KURNIAWATIPengembangan Lembar Kerja Berbasis Inkuiri Terintegrasi Kelompok Mata Pelajaran Perekat Bangsa Untuk Menumbuhkan Kemampuan Berpikir Dan Karakter Ilmiah Siswa984BaruStatus usulan:0511058402UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:DHINIATY GULARSOThe Inquiry of Indegenous Culture Sebagai Model Pembelajaran Mata Kuliah Pendidikan Kebudayaan Daerah Untuk Meningkatkan Kreatifitas Mahasiswa 985BaruStatus usulan:0515028001UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:HJ. ENIK NURKHOLIDAHMeningkatkan Karakter Emphaty dan Self-Actualization Melalui Pengembangan Pribadi Konselor986BaruStatus usulan:0528107103UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:BUDIHARTIPengaruh Pendekatan Matematika Realistik dan Ketrampilan Membaca Terhadap Kemampuan Pemecahan Masalah Soal Cerita pada Siswa Sekolah Dasar987BaruStatus usulan:0511088501UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:NIKEN WAHYU UTAMI S.Pd.Si, M.PdSTUDI KOMPARATIF PEMBELAJARAN YANG MENGGUNAKAN E-LEARNING DAN BAHAN AJAR CETAK TERHADAP KEMANDIRIAN BELAJAR DAN KREATIVITAS MAHASISWA988BaruStatus usulan:0522048401UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:RIDWAN BUDI PRAMONO S.Psi, M.APelatihan "Inilah Komitmenku" Untuk Meningkatkan Komitmen Organisasi Pengurus OSIS SMA Se-Kota Yogyakarta (Revitalisasi Peran OSIS Dalam Sekolah)989BaruStatus usulan:0522018401UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:LAELA SAGITA S.Pd, M.ScPengembangan Media Interaktif Menggunakan Software Authoring Tools Lectora Pada Mata Kuliah Kajian Matematika SMA 2 untuk Meningkatkan Disposisi Matematika990BaruStatus usulan:0522128402UNIVERSITAS PGRI YOGYAKARTA051015Penelitian Dosen PemulaKode:ROSALIA WIDIASTUTIFENOMENA PERUBAHAN PEKERJAAN PETANI KE PEKERJAAN NELAYAN di Desa Purwodadi Kecamatan Tepus Kabupaten Gunungkidul991BaruStatus usulan:0528086901UNIVERSITAS GUNUNG KIDUL051017Penelitian Dosen PemulaKode:124

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI SURYANTI S.P., M.P.Kajian Sifat Fisiologi Kultivar Kedelai dan Ketahanan terhadap Cekaman Kekeringan992BaruStatus usulan:0518027202UNIVERSITAS GUNUNG KIDUL051017Penelitian Dosen PemulaKode:TANTIN PRISTYAWATIEvaluasi Kekosongan Trayek Angkutan Pedesaan (Angkudes) di Kabupaten Gunungkidul993BaruStatus usulan:0527038102UNIVERSITAS GUNUNG KIDUL051017Penelitian Dosen PemulaKode:YULI ASRININGTIASImplementasi Teknologi Flash remoting Untuk Administrasi Jabatan Akademik Dosen (Studi Kasus:Biro Kepegawaian Kopertis Wilayah V)994BaruStatus usulan:0528077501UNIVERSITAS TEKNOLOGI YOGYAKARTA051018Penelitian Dosen PemulaKode:WIDI FAJAR WIDYATMOKOPENGARUH KOGNITIF DARI DESAIN INSTRUMENT PANEL MOBIL LISTRIK995BaruStatus usulan:0502028502UNIVERSITAS TEKNOLOGI YOGYAKARTA051018Penelitian Dosen PemulaKode:ARI ZAQI AL-FARITSYPENINGKATAN PRODUKTIVITAS PERUSAHAAN DENGAN MENGGUNAKAN METODE SIX SIGMA, LEAN DAN KAIZEN996BaruStatus usulan:0522088301UNIVERSITAS TEKNOLOGI YOGYAKARTA051018Penelitian Dosen PemulaKode:SEKAR AKROM FARADIZASTATEGI MENGATASI COMMON MEASURES BIAS DALAM BALANCED SCORECARD997BaruStatus usulan:0509128701UNIVERSITAS TEKNOLOGI YOGYAKARTA051018Penelitian Dosen PemulaKode:RATNA LISTIANA DEWANTIModel Prediksi Minat Mahasiswa Berwirausaha dengan Pendekatan Theory of Planned Behavior998BaruStatus usulan:0512087301UNIVERSITAS TEKNOLOGI YOGYAKARTA051018Penelitian Dosen PemulaKode:Ir TYASTUTI PURWANI M.P.UPAYA PENGEMBANGAN JAGUNG PUTIH LOKAL SEBAGAI BAHAN PANGAN ALTERNATIF : RAGAM GENETIK DAN DAYA WARIS SIFAT-SIFAT PERTUMBUHAN DAN HASIL 999BaruStatus usulan:0524096301Universitas Mercu Buana Yogyakarta051019Penelitian Dosen PemulaKode:125

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARENY YUNIASANTI S.Psi., M.PsiPengaruh Pendidikan Kewirausahaan terhadap Intensi Berwirausaha Mahasiswa Universitas Mercu Buana Yogyakarta1000BaruStatus usulan:0512068104Universitas Mercu Buana Yogyakarta051019Penelitian Dosen PemulaKode:NUGRAENIPengaruh Standar Akuntansi Pemerintah terhadap Kualitas Laporan Keuangan dan Implikasinya terhadap Akuntabilitas Kinerja1001BaruStatus usulan:0022017201Universitas Mercu Buana Yogyakarta051019Penelitian Dosen PemulaKode:AWAN SANTOSAMembangun Hubungan dengan Pelanggan pada Usaha Kecil dan Menengah dalam Kontek Pemasaran B2C dan B2B1002BaruStatus usulan:0015047901Universitas Mercu Buana Yogyakarta051019Penelitian Dosen PemulaKode:SUPATMANDETEKSI CITRA SKETSA FIGUR MANUSIA DENGAN METODE PULSE COUPLED NEURAL NETWORK (PCNN) UNTUK MEMPREDIKSI KEMATANGAN EMOSIONAL1003BaruStatus usulan:0509057202Universitas Mercu Buana Yogyakarta051019Penelitian Dosen PemulaKode:SUGENG WINARDIRANCANG BANGUN ANALISIS PENGENALAN TULISAN TANGAN AKSARA HANACARAKA1004BaruStatus usulan:0507016801Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:V WIRATNA SUJARWENI M.M.Studi Peran Perempuan Dalam Pengembangan UMKM Melalui Teknologi Informasi untuk Meningkatkan Kinerja Studi Kasus di Wilayah DIY1005BaruStatus usulan:0526057801Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:LESTARININGSIHPelaksanaan Program Inisiasi Menyusu Dini Terhadap Kelangsungan Pemberian ASI Eksklusif1006BaruStatus usulan:0524107901Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:ANDRE KUSSUMA ADIPUTRAAnalisis Faktor Penentu Keberhasilan Kelompok Usaha Bersama (Kube) Studi Kasus Di Kabupaten Bantul1007BaruStatus usulan:0524097303Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:126

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrg. THERESIA PUSPITAWATI M.Kes.Analisis Komunikasi Asertif Pasien dalam Mengkases Pelayanan Kesehatan di Rumah Sakit Umum Daerah Sleman, Daerah Istimewa Yogyakarta1008BaruStatus usulan:0529086603Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:SUKISMANTOPengaruh Aerasi dan Filtrasi sederhana terhadap Warna, Kekeruhan, Kadar Fe dan Mn sumber air bersih warga di Wilayah Desa Argomulyo Cangkringan Sleman DIY1009BaruStatus usulan:0518108101Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:EVRITA LUSIANA UTARIPengenalan Pola Sinyal Kardiografi Dengan Menggunakan Alih Ragam Gelombang Singkat1010BaruStatus usulan:0529047901Universitas Respati Yogyakarta051020Penelitian Dosen PemulaKode:SIGIT PRIYAMBODO ST. MT.Aplikasi Sensor Ultrasonic Untuk Sulosi Parkir yang Aman Pada Kendaraan Bermotor Roda-4 Berbasis Mikrokontroller AT-Mega81011BaruStatus usulan:0518096703INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:SITI SAUDAH S.Pd., M.Hum.PEMBELAJARAN MODEL THINK-TALK-WRITE (TTW) SEBAGAI SOLUSI PENGEMBANGAN JIWA KEPEMIMPINAN (LEADERSHIP)1012BaruStatus usulan:0515027101INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:SUBANDI ST. MT.Pemanfaatan Energi Matahari Sebagai Penyiraman Kebun Salak diMusim Kemarau Dengan Menggunakan solar cell. 1013BaruStatus usulan:0527105801INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:Ir. HARY WIBOWO MT.Rancang Bangun Mesin pengering Padi Portabel Sistem getar Berbahan Bakar Sekam1014BaruStatus usulan:0529066101INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:AGUS DUNIAWANPengaruh PWHT Terhadap Struktur Mikro, Uji Kekerasan dan Ketangguhan pada Sambungan Las Tak Sejenis Austenitic Stainless Steels dan Baja Karbon1015BaruStatus usulan:0511115601INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:127

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANAK AGUNG PUTU SUSASTRIAWAN S.T., KARAKTERISTIK FISIS DAN TERMAL BRIKET KOMPAKSI SERBUK KAYU1016BaruStatus usulan:0508107701INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:PURNAWANDelignifikasi Nitrat - Soda Limbah Serat industri Tepung Aren Sebagai Bahan Kertas (PILP)1017BaruStatus usulan:0508106202INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:SRI RAHAYU GUSMARWANISimultaneous Detoxification-Fermentation for Ethanol Booster in Fermentation Process1018BaruStatus usulan:0511077101INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:ANI PURWANTI ST, M.Eng.Optimasi Pengambilan Minyak dari Mikroalga menggunakan Autoklaf sebagai Upaya meningkatkan Rendemen dan Mutu Minyak1019BaruStatus usulan:0502048101INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:RR Y RACHMAWATI KUSUMANINGSIH ST. MT.Pengembangan Model Laboratorium Virtual sebagai Solusi Keterbatasan Sumber Daya Pembelajaran1020BaruStatus usulan:0512077001INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:SAMUEL KRISTIYANA ST., MT.SISTEM DETEKTOR ARAH SINYAL RF MENGGUNAKAN ANTENA DOPLLER1021BaruStatus usulan:0506127002INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:AJI PRANOTO S.Pd., M.PdIdentifikasi Kerusakan Injektor pada Mobil Elektronik Fuel Injektion (EFI)dan Cara Mengatasinya dengan Mudah dan Murah1022BaruStatus usulan:0011067101INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:JOKO TRIYONOPenggunaan Jejaring Sosial Twitter untuk mengelola Stok Simplisia di Assosiasi BioFarmaka As-Syifa Tempuran, Kecamatan Tempuran Kabupaten Magelang1023BaruStatus usulan:0506086702INSTITUT SAINS DAN TEKNOLOGI AKPRIND052003Penelitian Dosen PemulaKode:128

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADIMAS DEWORO PURUHITO SP, MPTinjauan Sosial dan Ekonomi Sistem Transportasi Tandah Buah Segar Kelapa Sawit Antara Pengelolaan Perusahaan Dan Koperasi Petani1024BaruStatus usulan:0519127001INSTITUT PERTANIAN STIPER052004Penelitian Dosen PemulaKode:DANDUNG RUDY HARTANASTUDI EKPERIMENTAL PENGARUH THROAT RATIO TERHADAP KINERJA EJECTOR1025BaruStatus usulan:0507106802SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:FADLINPEMETAAN ANCAMAN BAHAYA PRIMER LETUSAN G. MERAPI KE ARAH SELATAN BERDASARKAN KARAKTERISTIK ABU - LAPILI AWAN PANAS ERUPSI 20101026BaruStatus usulan:0514048201SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:MOHAMMAD ARSYADEvaluasi Kepuasan Mahasiswa Terhadap Kinerja Sistem Informasi Akademik di STTNAS Yogyakarta1027BaruStatus usulan:0509047001SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:SOLIKHAH RETNO HIDAYATIMODEL SISTEM PERWILAYAHAN DI WILAYAH STRATEGIS EKONOMI JOGLOSEMAR BERBASIS KINERJA KOTA KECIL1028BaruStatus usulan:0502017501SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:R ANDY ERWIN WIJAYA S.T, M.T.Evaluasi Kualitas Massa Batuan pada Zona Cavity Tambang Batugamping dengan Menggunakan Metode Geological Strength Index di Kabupaten Tuban Propinsi Jawa Timur1029BaruStatus usulan:0501047602SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:JOKO PRASOJOAplikasi Radio Frequency Identification (RFID)Sebagai Starter Key Elektrik Digital Berbasis Mikrokontoller1030BaruStatus usulan:0503046901SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:HASTA KUNTARA S.T., M.T.PERANCANGAN ALAT UJI KEAUSAN ABRASIF DENGAN PENGGERAK PNEUMATIK1031BaruStatus usulan:0504027301SEKOLAH TINGGI TEKNOLOGI NASIONAL053002Penelitian Dosen PemulaKode:129


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANUNING KRISTIANI SE., MMAnalisis Perbedaan Penerapan Praktik "Green Business" Terhadap Fungsi Bisnis Berdasarkan Faktor Demografis Perusahaan: Studi Persepsi Pada UKM di Yogyakarta1040BaruStatus usulan:0518058101SEKOLAH TINGGI ILMU EKONOMI YKPN053003Penelitian Dosen PemulaKode:EVI ROSALINA WIDYAYANTI SE. MMPENGARUH PENERAPAN GOOD CORPORATE GOVERNANCE PERUSAHAAN ASURANSI TERHADAP PERUBAHAN PERSEPSI MASYARAKAT (Studi Pada Perusahaan Asuransi di Yogyakarta )1041BaruStatus usulan:0510047401SEKOLAH TINGGI ILMU EKONOMI WIDYA WIWAHA053004Penelitian Dosen PemulaKode:Dra. AGUSTA IKA PRIHANTI NUGRAHENI ADOPSI TEKNOLOGI INFORMASI OLEH USAHA MIKRO KECIL DAN MENENGAH DENGAN PENDEKATAN TECHNOLOGY ACCEPTANCE MODEL (Studi Kasus Pada UMKM di DIY)1042BaruStatus usulan:0523088001SEKOLAH TINGGI ILMU EKONOMI WIDYA WIWAHA053004Penelitian Dosen PemulaKode:AGUS SUYANTO S.Hut, M.ScPEMANFAATAN HASIL HUTAN BUKAN KAYU (HHBK) OLEH MASYARAKAT DI KABUPATEN GUNUNG KIDUL1043BaruStatus usulan:0016037501SEKOLAH TINGGI TEKNIK LINGKUNGAN053007Penelitian Dosen PemulaKode:ARIESTA DAMAYANTI S.Kom.PEMANFAATAN SISTEM INFERENSI FUZZY MAMDANI UNTUK PEMETAAN DAERAH POTENSI TUJUAN WISATA DI KABUPATEN BANTUL1044BaruStatus usulan:0020047801STMIK AKAKOM053010Penelitian Dosen PemulaKode:ADI KUSJANI S.T.ANALISIS RMI (REMOTE METHOD INVOCATION) PADA JAVA MENGGUNAKAN CK (CHIDAMBER-KEMERER) METRICS1045BaruStatus usulan:0515067501STMIK AKAKOM053010Penelitian Dosen PemulaKode:ANDIKA AGUS SLAMETOPenerapan Openssh dan Bash Script Untuk Simultaneous Remote Access Client Pada Laboratorium STMIK AMIKOM Yogyakarta1046BaruStatus usulan:0522088001STMIK AMIKOM053021Penelitian Dosen PemulaKode:MEI PARWANTO KURNIAWANPerancangan dan Pembuatan Media Pembelajaran Bahasa Jawa Dengan Teknik Masking 1047BaruStatus usulan:0512058501STMIK AMIKOM053021Penelitian Dosen PemulaKode:131

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATRI SUSANTOEVALUASI SISTEM INFORMASI AKADEMIK DENGAN METODE END USER COMPUTING SATISFACTION( STUDY KASUS STMIK AMIKOM YOGYAKARTA )1048BaruStatus usulan:0526077801STMIK AMIKOM053021Penelitian Dosen PemulaKode:FERRY WAHYU WIBOWOInstrumentasi Pengenalan Kendaraan Berbasis Computer Vision Untuk Analisa Polusi Udara1049BaruStatus usulan:0521058101STMIK AMIKOM053021Penelitian Dosen PemulaKode:HANIF AL FATTA M.KomAnalisis Pengembangan Dan Perancangan Sistem Informasi Akademik Smart Berbasis Cloud Computing Pada Sekolah Menengah Umum Negeri (SMUN) Di Daerah Istimewa Yogyakarta1050BaruStatus usulan:0517027901STMIK AMIKOM053021Penelitian Dosen PemulaKode:TONNY HIDAYATPENERAPAN TEKNOLOGI AUGMENTED REALITY SEBAGAI MODEL MEDIA EDUKASI KESEHATAN GIGI BAGI ANAK1051BaruStatus usulan:0524088501STMIK AMIKOM053021Penelitian Dosen PemulaKode:BARKA SATYASISTEM PAKAR UNTUK MENDIAGNOSA PENYAKIT CAMPAK PADA MANUSIA1052BaruStatus usulan:0505067902STMIK AMIKOM053021Penelitian Dosen PemulaKode:S.Si EKO PRAMONO M.T.Implementasi RoIP (Radio Over IP) pada Komunikasi Tanggap Bencana 1053BaruStatus usulan:0522067101STMIK AMIKOM053021Penelitian Dosen PemulaKode:HANI RUBIANIDeployment Jaringan Sensor Nirkabel Berdasarkan Cakupan Area dan Waktu Hidup Sensor Node Menggunakan Algoritma Particle Swarm Optimization1054BaruStatus usulan:0530058101STMIK AMIKOM053021Penelitian Dosen PemulaKode:ANTON SETIAWAN HONGGOWIBOWO S.KOM, Perancangan Sistem Pendukung Keputusan Untuk Peningkatan Jabatan Dan Perencanaan Karir1055BaruStatus usulan:0513047901SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:132

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUHAMMAD ARDI CAHYONO ST., MT.Analisis Pemilihan Desain Struktur dan Pembuatan Purwarupa Bilah Turbin Angin Komposit1056BaruStatus usulan:0418037201SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:MUHROM KHUDHORIPENGARUH LETAK NOZZLE VENTURY MIXER TERHADAP UNJUK KERJA GENSET BERBAHAN BAKAR HYBRID (BIOGAS-BENSIN) DI PILOT PLANT DME (DESA MANDIRI ENERGI) BERBAH1057BaruStatus usulan:0516027303SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:YASRIN ZABIDI ST, MTPengukuran dan Analisis Kinerja Industri Kreatif Gerabah Kasongan Bantul Guna Meningkatkan Daya Saing dan Kekuatan Daerah1058BaruStatus usulan:0526017601SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:DENNY DERMAWANPerancangan Visual Docking Guidance System (VDGS)untuk Sistem Parkir Pesawat Terbang1059BaruStatus usulan:0011117101SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:KRIS HARIYANTOPengembangan Sistem Pembakaran Berbasis Simplifity, Cost Efectiveness, Eficiency dan Safety Pada Kompor Berbahan Bakar Bio-Fuel Untuk Derah Mandiri Energi di Yogyakarta1060BaruStatus usulan:0527097601SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:Drs. AGUS BASUKESTI M.T.Perancangan Sistem Tele-Navigation pada Pesawat Tanpa Awak (UAV)1061BaruStatus usulan:0520086402SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:NURCAHYANI DEWI RETNOWATI S.Far, Apt., Animasi 2 Dimensi Rute Perjalanan Bus Trans Jogja Berbasis Web1062BaruStatus usulan:0518078101SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:UYUUNUL MAUIDZOH ST., MT.ANALISIS RANTAI PASOKAN BATIK PEWARNA ALAM (STUDI KASUS DI KECAMATAN BAYAT KLATEN)1063BaruStatus usulan:0511047201SEKOLAH TINGGI TEKNOLOGI ADISUTJIPTO053024Penelitian Dosen PemulaKode:133



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMALUTFI NURDIAN ASNINDARI M.ScPENGARUH LATIHAN FISIK TERATUR DAN TERUKUR TERHADAP KUALITAS KULIT TIKUS SPRAGUE DAWLEY YANG DILAKUKAN OVAERIEKTOMI. Kajian terhadap Ekspresi Reseptor Estrogen α dan Jumlah Fibroblast Kulit1080BaruStatus usulan:0523028001SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH053033Penelitian Dosen PemulaKode:SARWINANTI M.KepPengaruh Inisiasi Menyusu Dini terhadap proses involusio Uterus pada ibu post partum di RS PKU Muhammadiyah Yogyakarta 1081BaruStatus usulan:0526067301SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH053033Penelitian Dosen PemulaKode:ASRI HIDAYAT M.Keb.HUBUNGAN PROSES BIMBINGAN PRAKTIK KLINIK KEBIDANAN IV DENGAN KOMPETENSI PERTOLONGAN PERSALINANMAHASISWA D III KEBIDANAN STIKES ‘AISYIYAH YOGYAKARTA1082BaruStatus usulan:0521086801SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH053033Penelitian Dosen PemulaKode:Dra. RETNO HARTATI M.B.A.ANALISIS PERBEDAAN EFEKTIVITAS ORGANISASI DITINJAU DARI KESESUAIAN , KEKUATAN, DAN TIPE BUDAYA1083BaruStatus usulan:0003025904SEKOLAH TINGGI ILMU MANAJEMEN YKPN053034Penelitian Dosen PemulaKode:Dra. TRI HARSINI WAHYUNINGSIH M.SiPengaruh Bauran Pemasaran terhadap Keputusan Pembelian Produk Asuransi pada Wanita Pekerja1084BaruStatus usulan:0531076701SEKOLAH TINGGI ILMU MANAJEMEN YKPN053034Penelitian Dosen PemulaKode:VIVIAN NANNY LIA DEWI S.S.T.PENGARUH PEMBERIAN TERAPI INFRA MERAH TERHADAP PENYEMBUHAN LUKA PERINEUM PADA IBU NIFAS DI RB AMANDA, GAMPING, SLEMAN, YOGYAKARTA1085BaruStatus usulan:0522078501SEKOLAH TINGGI ILMU KESEHATAN ACHMAD YANI YOGYA053035Penelitian Dosen PemulaKode:IDA NURSANTI S.Kep., Ns., MPHPengaruh Tindakan Fototerapi terhadap Praktik Pemberian ASI di Yogyakarta1086BaruStatus usulan:0619047702SEKOLAH TINGGI ILMU KESEHATAN ACHMAD YANI YOGYA053035Penelitian Dosen PemulaKode:EFFATUL AFIFAHEfek Pemberian Ekstrak Air Buah Sawo (Manilkara Sapota L) terhadap Kadar Glukosa Darah Tikus (Rattus Norvegicus) Diabetes Mellitus1087BaruStatus usulan:0529127701SEKOLAH TINGGI ILMU KESEHATAN ALMA ATA YOGYAKARTA053036Penelitian Dosen PemulaKode:136

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANUR INDAH RAHMAWATIEvaluasi Pelaksanaan Program Kelompok Pendukung Ibu dalam Peningkatan Cakupan Pemberian ASI Eksklusif di Kabupaten Bantul tahun 20141088BaruStatus usulan:0526098501SEKOLAH TINGGI ILMU KESEHATAN ALMA ATA YOGYAKARTA053036Penelitian Dosen PemulaKode:Ir EDDY YUSWORO MPPERBEDAAN KETAHANAN HIDUP ANTARA BIOAKTIVATOR DARI RUMEN SAPI DAN KOTORAN BEBEK SERTA EM-4 AKIBAT PERUBAHAN SUHU DAN KADAR OKSIGEN PADA PROSES PENGOMPOSAN1089BaruStatus usulan:0007016102AKADEMI PERTANIAN YOGYAKARTA054015Penelitian Dosen PemulaKode:RR CATUR GUNAWANTI S.Pi, M.P.IDENTIFIKASI KARAKTERISTIK DAN POLA KEMISKINAN NELAYAN DI KABUPATEN KULONPROGO YOGYAKARTA1090BaruStatus usulan:0508017701AKADEMI PERIKANAN YOGYAKARTA054017Penelitian Dosen PemulaKode:Drs AHMAD MUNTAHA M.SiBUDAYA KOMUNIKASI BARU DI DUNIA MAYA: STUDI INTERAKTIVITAS PEMERINTAH—WARGA SEBAGAI PARTISIPAN AKTIF PADA TIGA LAMAN PEMERINTAH KOTA DI INDONESIA (Yogyakarta, Surakarta, Surabaya) 1091BaruStatus usulan:0527056401AKADEMI KOMUNIKASI INDONESIA YPK054027Penelitian Dosen PemulaKode:SUPRIYANTAAplikasi Konversi Suara Ke Teks Berbahasa Indonesia Menggunakan Google Speech API1092BaruStatus usulan:0523036801AMIK BSI Yogyakarta054047Penelitian Dosen PemulaKode:ELLY MUNINGSIHPENERAPAN METODE K-MEANS UNTUK CLUSTERING PRODUK ONLINE SHOP DALAM PENENTUAN STOK BARANG (STUDI KASUS : ONLINE SHOP RAGAM JOGJA)1093BaruStatus usulan:0615097901AMIK BSI Yogyakarta054047Penelitian Dosen PemulaKode:ERA REVIKAperan, motivasi kader kesehatan dalam pelaksanaan kegiatan posyandu diwilayah panggungharjo1094BaruStatus usulan:1120028601AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:YUNI FITRIANAKarakteristik, Sikap, dan Perilaku Orang Tua Melakukan Kekerasan Verbal Pada Anak Usia Prasekolah di Dusun Sawahan, Kelurahan Pendowoharjo, Kecamatan Sewon,Kabupaten Bantul1095BaruStatus usulan:0529068401AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:137

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMACAHYANING SETYO HUTOMO SST., M.KEPengaruh Penyuluhan Terhadap Pengetahuan Kader Kesehatan Dengan Pemanfaatan Buku Kia Di Kabupaten Bantul Daerah Istimewa Yogyakarta1096BaruStatus usulan:0526108701AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:PRI HASTUTI S.Si.TPengaruh Pendidikan Kesehatan Melalui Ceramah Tentang Kehamilan Berisiko Terhadap Peningkatan Pengetahuan Kader Posyandu di Kabupaten Bantul1097BaruStatus usulan:0502127901AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:WINARSIH S.Si.TANALISIS PENYEBAB PEMBERIAN ASI NON EKSLUSIF PADA IBU RUMAH TANGGA1098BaruStatus usulan:0523078502AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:KURNIASARI PRATIWI S.PSI., M.Pengaruh Pendidikan Kesehatan Terhadap Pengetahuan Tentang Kanker Leher Rahim Pada Ibu Usia Reproduksi di Dusun Pengkol Desa Gulurejo Kelurahan Lendah Kecamatan Kulonprogo Tahun 20131099BaruStatus usulan:0502078402AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:ENDANG KHOIRUNNISA SST.Keb, M.KesPENGETAHUAN IBU TENTANG KEBUTUHAN GIZI SEIMBANG DENGAN PERTUMBUHAN ANAK DALAM UPAYA MENINGKATKAN GIZI ANAK DI WILAYAH PUSKESMAS SEWON 2 BANTUL1100BaruStatus usulan:0501027703AKADEMI KEBIDANAN YOGYAKARTA054050Penelitian Dosen PemulaKode:WISNU HADIGEJALA PERGESERAN MINAT WIRAUSAHA DITINJAU DARI ASPEKKREATIFITAS DAN MOTIVASI ANAK MUDA DI WILAYAH YOGYAKARTA1101BaruStatus usulan:0505067501Akademi Pariwisata BSI Yogyakarta054056Penelitian Dosen PemulaKode:S.E ANI WIJAYANTI M.MParSTRATEGI PENGEMBANGAN SENDANG BAGUSAN DAN MAKAM KYAI BAGUS KHASANTUKA SEBAGAI WISATA RELIGI DI GODEAN SLEMAN1102BaruStatus usulan:0503057802Akademi Pariwisata BSI Yogyakarta054056Penelitian Dosen PemulaKode:SUPATMIEFEKTIFITAS DURASI PEMBERIAN AROMATHERAPI INHALASI TERHADAP PENURUNAN MUAL DAN MUNTAH PADA ENAM JAM PERTAMA PASIEN POST OPERASI DENGAN ANESTESI UMUM1103BaruStatus usulan:0531037802Akademi Perawatan Karya Bakti Husada Yogyakarta054063Penelitian Dosen PemulaKode:138

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABUDI PUNJASTUTI S.Kep,Ns,M.P.HHUBUNGAN TINGKAT PENGETAHUAN TENTANG KANKER CERVIKS DENGAN PERILAKU SKRINING KANKER CERVIKS PADA IBU PASANGAN USIA SUBUR ( PUS ) DI WILAYAH KELURAHAN BUMIJO, JETIS, KOTA YOGYAKARTA 20141104BaruStatus usulan:0528117002Akademi Kesehatan Karya Husada Yogyakarta054066Penelitian Dosen PemulaKode:SITI MARYATI S. Kep. Ns, M.P.HEFEKTIFITAS KANGAROO MOTHER CARE DAN PIJAT BAYI TERHADAP PENINGKATAN BERAT BADAN DAN PANJANG BADAN PADA BAYI BERAT LAHIR RENDAH DI RUANG NEONATAL INTENSIVE CARE UNIT RSUD WATES1105BaruStatus usulan:0524066702Akademi Kesehatan Karya Husada Yogyakarta054066Penelitian Dosen PemulaKode:ABDUL AZIZ S.kep,NsStudi Komparasi pengukuran tekanan darah pada lengan atas dengan pergelangan kaki1106BaruStatus usulan:0520067601Akademi Kesehatan Karya Husada Yogyakarta054066Penelitian Dosen PemulaKode:BENNY KARUNIAWATISTUDI KOMPARASI TEKNIK MARMET DAN PIJAT OKSITOSIN TERHADAP PRODUKSI ASI PADA IBU POST PARTUM PRIMIPARA DI RUMAH SAKIT WILAYAH DAERAH ISTIMEWA YOGYAKARTA1107BaruStatus usulan:0517108601Akademi Kesehatan Karya Husada Yogyakarta054066Penelitian Dosen PemulaKode:ISWANTI PURWANINGSIHPengetahuan Mahasiswa D III Keperawatan tentang Patient Safety Di Daerah Istimewa Yogyakarta1108BaruStatus usulan:0527127601Akademi Kesehatan Karya Husada Yogyakarta054066Penelitian Dosen PemulaKode:DANIYANTO STOptimalisasi Efisiensi Energi Bagian Process House Pabrik Gula dengan Energy Utilization Diagram1109BaruStatus usulan:0505057601POLITEKNIK LPP055002Penelitian Dosen PemulaKode:ARI WIBOWO ST, M.EngSTUDI KELAYAKAN PENDIRIAN PABRIK KARET RIBBED SMOKED SHEET (RSS) DAN THIN BROWN CREPE (TBC) DI KEBUN PANCURSARI KABUPATEN MALANG1110BaruStatus usulan:0502048103POLITEKNIK LPP055002Penelitian Dosen PemulaKode:SUWANDHI M.SiPENGARUH FAKTOR KONTINJENSI SEBAGAI PEMODERASI TERHADAP HUBUNGAN PARTISIPASI PEMAKAI DAN KEBERHASILAN SISTEM INFORMASI DI PERKEBUNAN BESAR SWASTA1111BaruStatus usulan:0504095901POLITEKNIK LPP055002Penelitian Dosen PemulaKode:139

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARETNO MUNINGSIHKAJIAN FISIOLOGI BEBERAPA METODE PETIK TERHADAP HASIL PUCUK TEH (Camelia sinensis L. Kuntze) DI KEBUN TEH BEDAKAH PT TAMBI 1112BaruStatus usulan:0526037901POLITEKNIK LPP055002Penelitian Dosen PemulaKode:YUNAIDI ST., M.Eng.Perbandingan Kekerasan, Struktur Mikro, Komposisi Kimia, dan Kekuatan Tarik Rantai dan Sproket Sepeda Motor Produk Asli, OEM, dan non-OEM1113BaruStatus usulan:0505017701POLITEKNIK LPP055002Penelitian Dosen PemulaKode:ANNA KUSUMAWATI SP,MScPENGARUH VARIETAS BATANG PISANG SEBAGAI KOMPOS DAN MEDIA TANAM TERHADAP PERTUMBUHAN BIBIT KAKAO (Theobroma cacao L.)1114BaruStatus usulan:0505048602POLITEKNIK LPP055002Penelitian Dosen PemulaKode:Dra SRI PURWATI W W MBAPERBANDINGAN ANALISIS KEBANGKRUTAN PADA PERUSAHAAN PERKEBUNAN YANG TERDAFTAR DI BURSA EFEK INDONESIA1115BaruStatus usulan:0517116401POLITEKNIK LPP055002Penelitian Dosen PemulaKode:HARTINI SP, MScPEMANFAATAN JAMUR MIKORIZA ARBUSKULA (JMA) UNTUK MENINGKATKAN PERTUMBUHAN DAN KESEHATAN BIBIT KAKAO1116BaruStatus usulan:0516097901POLITEKNIK LPP055002Penelitian Dosen PemulaKode:Ir RUSMANTRI MPPENINGKATAN KUALITAS AMPAS SEBAGAI BAHAN BAKU GASIFIKASI DENGAN TORREFAKSI KERING1117BaruStatus usulan:0509035301POLITEKNIK LPP055002Penelitian Dosen PemulaKode:RATNA SRI HARJANTI ST, M.EngBiodiesel sebagai Alternatif Bahan Bakar dari Limbah Pabrik Gula Madukismo dan Minyak Jarak Pagar (Jatropha curcas) dengan Katalisator Zeolit Alam Klinoptilolite1118BaruStatus usulan:0020027801POLITEKNIK LPP055002Penelitian Dosen PemulaKode:FATHUR RAHMAN RIFAI STAplikasi Analisis Pinch untuk Menurunkan Konsumsi Steam di Bagian Process House Pabrik Gula1119BaruStatus usulan:0514088001POLITEKNIK LPP055002Penelitian Dosen PemulaKode:140

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr SAPTYAJI HARNOWO M.EngANALISIS KINERJA PEMBANGKIT LISTRIK TENAGA BIOMASSA SAWIT (PLTBS) PABATU PT PERKEBUNAN NUSANTARA IV (PERSERO)1120BaruStatus usulan:0529096201POLITEKNIK LPP055002Penelitian Dosen PemulaKode:SIGIT WIDADIPrototipe Akumulasi Akun Transaksi Pada Laporan Keuangan Akuntansi Menggunakan Struktur Relasi Tabel Tunggal1121BaruStatus usulan:0514037301POLITEKNIK MUHAMMADIYAH YOGYAKARTA055007Penelitian Dosen PemulaKode:ANA MARDIYANINGSIHPengembangan Potensi Ekstrak Daun Pandan Wangi (Pandanus amaryllifolius Roxb.)Sebagai Antimikroba dan Bahan Pengawet Pangan1122BaruStatus usulan:0520017701POLITEKNIK KESEHATAN BHAKTI SETYA INDONESIA055008Penelitian Dosen PemulaKode:FARISYA NURHAENIUJI AKTIVITAS ANTIOKSIDAN EKSTRAK ETANOLIK BERBAGAIJENIS SAYURAN SERTA PENENTUAN KANDUNGAN FENOLIKDAN FLAVONOID TOTALNYA1123BaruStatus usulan:0525117402POLITEKNIK KESEHATAN BHAKTI SETYA INDONESIA055008Penelitian Dosen PemulaKode:NUR ISMIYATISintesis dan Uji Aktivitas Sitotoksik Senyawa 1-(2,5-dihidroksifenil)-(3-piridin-2-il)-propenon terhadap Sel Kanker Kolon WiDr1124BaruStatus usulan:0519128405POLITEKNIK KESEHATAN BHAKTI SETYA INDONESIA055008Penelitian Dosen PemulaKode:RINA WIDIASTUTIPengaruh Berbagai Kadar Infusa Rimpang Kunyit (Curcuma domestica Val.) Terhadap Daya Awet Tahu1125BaruStatus usulan:0530037401POLITEKNIK KESEHATAN BHAKTI SETYA INDONESIA055008Penelitian Dosen PemulaKode:Dr. Ir. WIRANTO HERRY UTOMO M.Kom.TRANSFORMASI MODEL BISNIS UMKM BATIK PLUMPUNGAN SALATIGA BERBASIS TEKNOLOGI MOBILE1126BaruStatus usulan:0612076201UNIVERSITAS KRISTEN SATYA WACANA061001MP3EIKode:Prof. Dr. Ir. SONY HERU PRIYANTO M.M.Penyusunan Integrated Radial Cycle (IRC)Model Berbasis Ekonomi Kerakyatan Guna Peningkatan Daya Saing Industri Makanan Olahan Di Koridor Ekonomi Jawa : Implementasi R & D Approach 1127BaruStatus usulan:0614096601UNIVERSITAS KRISTEN SATYA WACANA061001MP3EIKode:141

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUCHAYATIN SE, MMMe-marketable-kan obyek wisata alam gonoharjo Kabupaten Kendal 1128BaruStatus usulan:0619026401UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:Dra SITI AMINAH M.M.PENGARUH FAKTOR GENDER TERHADAP KINERJA DOSEN PERGURUAN TINGGI SWASTADI KOTA SEMARANG1129BaruStatus usulan:0604076302UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:Dra. SUPARMI M.M.PENGARUH ORIENTASI NILAI BUDAYA, KOMPENSASI DAN KEPUASAN KERJA TERHADAP KINERJA GURU-GURU DI KOTA SEMARANG1130BaruStatus usulan:0605066802UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:ANGGRAENI ENDAH KUSUMANINGRUM SH. Peranan Dinas Tenaga Kerja dan Transmigrasi Dalam Penyaluran Tenaga Kerja dan Transmigrasi di Kabupaten Rembang1131BaruStatus usulan:0605106301UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:ANIEK TYASWATI WIJI LESTARI SH. M.Hum.ANALISIS TERHADAP PERLINDUNGAN HUKUM SIMPANAN NASABAH BANK DALAM BENTUK TABUNGAN(STUDI PADA BANK UMUM DI KOTA SEMARANG)1132BaruStatus usulan:0602126201UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:HADI KARYONO SH. M.Hum.Optimalisasi Fungsi Lembaga Pemberdayaan Masyarakat Dalam Program Akselerasi Keluarga Sejahtera Pada Masyarakat pra Sejahtera di Pekalongan Kota1133BaruStatus usulan:0602076401UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:Dra KHAMIMAH SE. M.M.MEMBANGUN KEUNGGULAN BERSAING BERKELANJUTAN MELALUI KAPABILITAS MODAL SOSIAL DAN KINERJA PEMASARAN PADA PENGRAJIN WINGKO BABAT DI KOTA SEMARANG1134BaruStatus usulan:0616046701UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:Dra KARSIATI MSiFAKTOR – FAKTOR YANG MEMPENGARUHI AUDIT DELAY PADA PERUSAHAAN MANUFAKTUR YANG TERDAFTAR DI BURSA EFEK INDONESIA1135BaruStatus usulan:0614056001UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:142

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADYAH ILMININGTYAS S.Pi., MP.Abon, Stik dan Kerupuk Alternatif Diversifikasi Olahan Lele Tanpa Limbah untuk Meningkatkan Nilai Ekonomis dan Daya Saing Lele (Clarias Sp) 1136BaruStatus usulan:0608057101UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:SRI MURYATIPenggunan Strategi Penerjemahan Kosakata Budaya Jawa Tengah Berbahasa Indonesia ke dalam Bahasa Jepang dalam Media Informasi Pariwisata Jawa Tengah 1137BaruStatus usulan:0630087501UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:Dra. SRI PUJI LESTARI M.M.Tolok Ukur Daya Saing Antara Buah Jeruk Lokal dan Buah Jeruk Impor dilihat dari Sikap Kepercayaan Konsumen di Kota Semarang1138BaruStatus usulan:0625126501UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:HERU EKO PRASETYO SE. M.M.ANALISIS PENGARUH KOMUNIKASI DAN MOTIVASI TERHADAP KINERJA AUDITOR (STUDY KASUS PADA KANTOR AKUNTAN PUBLIK DI JAWA TENGAH)1139BaruStatus usulan:0622026601UNIVERSITAS 17 AGUSTUS 1945 SEMARANG061003Penelitian Dosen PemulaKode:SAMBODO SRIADI PINILIH S.Kep., Ne., M.Kep.Efektifitas Afirmasi Positif Terhadap Kecemasan Penderita Tuberculosis Paru Di Balai Kesehatan Paru Masyarakat (BKPM) Kota Magelang1140BaruStatus usulan:0613097601UNIVERSITAS MUHAMMADIYAH MAGELANG061004Penelitian Dosen PemulaKode:ENIK SUHARIYANTI S.KepEfektifitas Latihan Perilaku Asertif dalam Mencegah Kekerasan pada Anak1141BaruStatus usulan:0619017604UNIVERSITAS MUHAMMADIYAH MAGELANG061004Penelitian Dosen PemulaKode:PRASOJO PRIBADI S.Farm., Apt., M.Sc.EFEKTIFITAS PERASAN BUAH KEPEL (Stelechocarpus burahol (Blume) Hook.& Thomson) SEBAGAI ANTISEPTIK LUKA1142BaruStatus usulan:0607038304UNIVERSITAS MUHAMMADIYAH MAGELANG061004Penelitian Dosen PemulaKode:MUHDIYANTO SEPemodelan Stres Kerja dalam Mendorong Intensitas Keluar (Studi Empiris Perusahaan Ansuransi di Wilayah Kedu)1143BaruStatus usulan:0615077601UNIVERSITAS MUHAMMADIYAH MAGELANG061004Penelitian Dosen PemulaKode:143


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABARKAH SUSANTO SE., M.Sc.PROSPEK IMPLEMENTASI SAK ETAP BERBASIS KUALITAS LAPORAN KEUANGAN UMKM1152BaruStatus usulan:0627018002UNIVERSITAS MUHAMMADIYAH MAGELANG061004Penelitian Dosen PemulaKode:SITI ARIFAH M.SiKontribusi Desentralisasi Fiskal Terhadap Tingkat Korupsi Pada Era Otonomi Daerah di Indonesia1153BaruStatus usulan:0008067801UNIVERSITAS TIDAR MAGELANG061005Penelitian Dosen PemulaKode:C PRIMA FERRI K S.Pd., M.Pd.DEVELOPING A LEARNING MODEL TO PROMOTE STUDENTS’ CHARACTER BUILDING USING SELF-REGULATED LEARNING IN SPEAKING CLASS OF ENGLISH DEPARTMENT1154BaruStatus usulan:0619097501UNIVERSITAS TIDAR MAGELANG061005Penelitian Dosen PemulaKode:LILIA INDRIANI S.Pd.M.PdDeveloping EFL Writing Through Re-sequence Picture and Collaborative Writing1155BaruStatus usulan:0628118101UNIVERSITAS TIDAR MAGELANG061005Penelitian Dosen PemulaKode:SISWADIPENGARUH MACAM MEDIA TERHADAP PERTUMBUHAN DAN HASIL SELADA ( Lactuca sativa L) HIDROPONIK1156BaruStatus usulan:0608055901UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:AYU ISTIANA SARIIMPLEMENTASI PEMBELAJARAN BAHASA INGGRIS DENGAN MEDIA ANIMASI BERBASIS CERITA RAKYAT UNTUK MENINGKATKAN KOMPETENSI MENULIS NARASI DAN SEBAGAI INTERNALISASI NILAI NILAI KEARIFAN LOKAL (Studi Pada Siswa MTs Al Huda Gondangrejo Karanganyar )1157BaruStatus usulan:0616118202UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:AGATHA JUMIATIPemenuhan Hak Ank Untuk Berpartisipasi Dalam Pembangunan Di Kota Surakarta( implementasi terhadap Peraturan Walikota Surakarta no. 3-B tahun 20131158BaruStatus usulan:0605026701UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:MARTANAPERANAN PEMBERIAN TANAH HUTAN JATI PADA PENYERAPAN P DAN HASIL BAWANG PUTIH (Allium sativum L.) DI KECAMATAN TAWANGMANGU1159BaruStatus usulan:0004035501UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:145

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUTARNO SE, M.SiModel tabungan rumah tangga pedesaan (Studi Kasus di Kecamatan Delanggu Kabupaten Klaten)1160BaruStatus usulan:0619077101UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:LAMIDI SE, M.SiPENGARUH MEREK DAN KEPERCAYAAN KONSUMENTERHADAP PREFERENSI KONSUMSI DALAM UPAYAMEMBANGUN EKUITAS WISATA KULINER DI KOTA SOLO1161BaruStatus usulan:0631087102UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:SHINTA RUKMI BUDIASTUTI SH, M.HumKebijakan Penjatuhan Sanksi Tindakan Sebagai Upaya Perlindungan Terhadap Anak Dalam Pembaharuan Hukum Di Indonesia 1162BaruStatus usulan:0623087702UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:ARIS EDY SARWONO SE, M.Si,AkPengujian Model Keberhasilan Penerapan Sistem Informasi Keuangan Daerah (SIKD) dalam rangka Peningkatan Good Corporate Governance (GCG) Survei pada Pengguna SKID Pemkot dan Pemkab Di Eks Karisidenan Surakarta.1163BaruStatus usulan:0626117401UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:RETNO SUSANTI SE, MMAnalisis Peran Even Budaya Dalam Menguatkan Potensi Pasar Untuk Meningkatkan Pendapatan Pedagang Pasar Antik dan Seni Ngarsopuro Solo1164BaruStatus usulan:0628017101UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:Drs SUNARSO MMPEDAGANG KECIL BERMITRA DENGAN BANK PLECIT (Survei di Kabupaten Sragen)1165BaruStatus usulan:0626056601UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:JOSEF PURWADI SETIODJATI SH, M.HumUPAYA PEMBERDAYAAAN KONSUMEN MELALUI PENDIDIKAN KONSUMEN UNTUK MEWUJUDKAN KEADILAN BERDASARKAN NILAI PANCASILA1166BaruStatus usulan:0626027001UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:ANITA TRISIANA S.Pd, MHPENGEMBANGAN PENDEKATAN SAINTIFIK KOLABORATIF DALAM KURIKULUM 2013 PADA PEMBELAJARAN PENDIDIKAN PANCASILA DAN KEWARGANEGARAAN BAGI GURU SEKOLAH MENENGAH ATAS DI SURAKARTA1167BaruStatus usulan:0722048004UNIVERSITAS SLAMET RIYADI061006Penelitian Dosen PemulaKode:146

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASITI MUNTAHANAH S.E.,M.Si.ANALISIS KINERJA MANAJERIAL DITINJAU DARI PERSPEKTIFPEMASARAN DAN KEUANGAN PADA USAHA KECIL MENENGAH(UKM) HOME INDUSTRI PECI DI BANDUNGSRUNI KEBUMEN1168BaruStatus usulan:0613127101UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:ELLY KRISTIANI PPeran Syahbandar dalam Penegakkan Hukum Laut (Studi Kasus Pencemaran Minyak di Laut Cilacap oleh Kapal Tanker)1169BaruStatus usulan:0608017001UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:HARSUTI S.E., M.Si.Dilematik Batasan Struktur Keuangan pada Usaha Retail di Kabupaten Banyumas1170BaruStatus usulan:0615126501UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:WITA WIDYANDINIPOLA PERMUKIMAN KOMUNITAS ISLAM ABOGE DI DESA CIKAKAK, WANGON, BANYUMAS1171BaruStatus usulan:0605057801UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:HENING RIYADININGSIH S.E.,M.S.iTIPOLOGI KEPRIBADIAN KARYAWAN UMKM DALAM MENUNJANG KINERJA PERUSAHAAN(Studi Pada Perusahaan Batik di Kabupaten Banyumas) 1172BaruStatus usulan:0602127001UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:Dra FATWA ZUHAENA M.SiSwakelola Manajemen Buruh1173BaruStatus usulan:0613126202UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:DWI JATI LESTARININGSIHPENGARUH PAPAN REKLAME TERHADAP ESTETIKA ARSITEKTUR KORIDOR KOMERSIAL KOTA PURWOKERTO1174BaruStatus usulan:0629036201UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:TRI WATININGSIHTeknologi Microcontroller Untuk Pengembangan Budidaya Buah-buahan Sistem Tabulapot1175BaruStatus usulan:0625086501UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:147

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUPRANOTODaun Tempuyung sebagai Tambahan Pakan Pembentuk Daging Bebek Rendah Kolesterol1176BaruStatus usulan:0624026801UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:CAHYANINGTYAS RIA URIPIEFEK MODERASI SWITCHING COST PADA TRUST, SATISFACTION DAN LOYALTY PENGGUNA BLACKBERRY SMARTPHONES1177BaruStatus usulan:0631087301UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:RATNA PUJI ASTUTI S.E., M.SiSpiritual Leadership dalam Upaya Meningkatkan Kinerja Perangkat Desa Di Kabupaten Banyumas1178BaruStatus usulan:0621126901UNIVERSITAS WIJAYA KUSUMA061007Penelitian Dosen PemulaKode:RIZKYSARI MEIMAHARANIE-Commerce Goody Bag Spunbond Menggunakan Qr Code Berbasis Web Responsif Studi Kasus : Vantacy Shop1179BaruStatus usulan:0620058501UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:NOOR AZISANALISIS PENINGKATAN PRODUKSI GARAM RAKYAT DENGAN METODE KRISTALISASI DI ATAS MEJA GARAM1180BaruStatus usulan:0609107501UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:Dra FARIDA YULIANI M.SiEKSPLORASI ENDOFIT ASAL TANAMAN ARTEMISIA(Artemisia annua) YANG BERPOTENSI SEBAGAI BIOPESTISIDATERHADAP FUNGI PENYEBAB PENYAKIT ANTRAKNOSA PADA TANAMANCABAI MERAH1181BaruStatus usulan:0014076202UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:INDAH LESTARI Pengembangan Media Bimbingan dan Konseling Berbasis Islami untuk Membentuk Karakter Mandiri Anak Usia Dini di Kabupaten Kudus1182BaruStatus usulan:0610118701UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:ANDY PRASETYO UTOMO S.Kom, MT.PENGAYAAN BAHAN AJAR SISTEM INFORMASI GEOGRAFISSTUDI KASUS : VISUALISASI INDUSTRI BORDIR DI KABUPATEN KUDUS BERBASIS SIGMENGGUNAKAN TITIK BEARING DAN DISTANCE1183BaruStatus usulan:0618058301UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:148

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAR RHOEDY SETIAWAN S.Kom., M.Kom.Rancang Bangun Sistem Informasi Geografis Perkembangan Industri Konveksi di Kabupaten Kudus1184BaruStatus usulan:0607067001UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:AGUNG DWI NURCAHYO S.S., M.Pd.PENERAPAN PEMBELAJARAN TERPADU MULTILINGUAL UNTUK MEMACU KEBERAKSARAAN ANAK MELALUI FILM ANIMASI(Studi Kasus: Sekolah Dasar Se-Kecamatan Dawe Kabupaten Kudus)1185BaruStatus usulan:0607037804UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:Drs. MOHAMMAD KANZUNNUDIN M. Pd.Pengembangan Ketrampilan Sosial Siswa pada Pembelajaran IPS Berbasis Keunggulan Lokal melalui Penerapan Reciprocal Learning Berbantu Media Cerita dan Metrik Ingatan1186BaruStatus usulan:0607016201UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:NURAENINGSIHPEMANFAATAN MATERI AJAR BAHASA INGGRIS SMK OLEH TENAGA KERJA INDUSTRI ROKOK DI KUDUS1187BaruStatus usulan:0612077901UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:RATIH HESTY UTAMI PUSPITASARIPENGARUH ORIENTASI PASAR DAN INOVASI PRODUK TERHADAP KINERJA PEMASARAN(Studi Empiris pada Industri Furniture skala sedang dan besar di Jepara )1188BaruStatus usulan:0624018301UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:MUTOHHARPENGEMBANGAN MEDIA CERITA BERGAMBAR ANAK DALAM PEMBELAJARAN BAHASA INGGRIS UNTUK MEREVITALISASI BUDAYA LOKAL KABUPATEN KUDUS DI ERA GLOBALISASI1189BaruStatus usulan:0621018302UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:ENDANG SUPRIYATIPerbandingan Ekstraksi Ciri Pada Data Mammogram Untuk Identifikasi Mikrokalsifikasi1190BaruStatus usulan:0629077402UNIVERSITAS MURIA KUDUS061009Penelitian Dosen PemulaKode:SUPARTINI SE., M.SiPENGARUH KUALITAS APBDes TERHADAP PENGAWASAN APBDes MENUJU TATA PEMERINTAHAN DESA YANG AKUNTABEL (STUDI EMPIRIS DI DESA-DESA SE KABUPATEN KARANGANYAR)1191BaruStatus usulan:0607106701UNIVERSITAS TUNAS PEMBANGUNAN061010Penelitian Dosen PemulaKode:149


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAVITA NURLATIFANALISIS DETERMINAN FAKTOR YANG BERHUBUNGAN DENGAN STUNTING PADA SISWA SD DI KABUPATEN PEKALONGAN1200BaruStatus usulan:0620048404UNIVERSITAS PEKALONGAN061011Penelitian Dosen PemulaKode:NIKEN WAHYU CAHYANINGTYAS MM.Dampak Risiko Sistematis dan Tidak Sistematis Terhadap Expected Return Saham Perusahaan Manufaktur di BEI jakarta Dengan Pendekatan Koreksi Beta1201BaruStatus usulan:0604097701UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:SOEBYAKTOSISTEM PEMBANGKIT LISTRIK TENAGA ANGINDI PANTAI KOTA TEGAL1202BaruStatus usulan:0603026001UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:YANTI PUJI ASTUTIE SE, MSI, AKFaktor-faktor yang Mempengaruhi Niat Adopsi SAK ETAP dan Penggunaan Teknologi Informasi dalam Pelaporan Keuangan UMKM: Studi Eksperimen Solomon1203BaruStatus usulan:0014097401UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:RUSNOTO M.Eng.Pembuatan Mesin Roller Untuk Mempercepat Proses Pengeringan Pelepah Pohon Pisang Sebagai Bahan Baku Pembuatan Kerajinan Packing Di KUB Batik Dahlia Kab. Tegal1204BaruStatus usulan:0604127401UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:MUHAMMAD FAQIHUDIN SE., M.Si.PENGARUH PRAKTEK PENGEMBANGAN SUMBER DAYA MANUSIA (SDM) DENGAN TINGKAT PRODUKTIVITAS KINERJA PEKERJA UKM DI WILAYAH KOTA TEGAL1205BaruStatus usulan:0620036601UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:HADI WIBOWOPENGARUH SUDUT SUDU KINCIR AERATOR TENAGA ANGIN PADA PENINGKATAN KADAR OKSIGEN1206BaruStatus usulan:0616047101UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:TOFIK HIDAYAT S.T., M.Eng.Pengembangan Desain Mesin Serba Guna Untuk Mengurangi Kelelahan Pekerja Siram Dan Semprot Tanaman Bawang Merah Di Desa Pesantunan, Kecamatan Wanasari, Kabupaten Brebes1207BaruStatus usulan:0619026902UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:151

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAS.T AHMAD FARID M.TOPTIMALISASI LAJU ALIRAN UDARA PADA RUANG PENGERING RUMPUT LAUT (GRACILARIA) DI KABUPATEN BREBES1208BaruStatus usulan:0611107602UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:NINIK UMI HARTANTI S.Si., M.Si.Kemampuan Daya Apung Pelet dengan Teknik Fermentasi bersumber Bahan Nabati yang berbeda1209BaruStatus usulan:0612057601UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:SISWIYANTI S.T., M.T.Aplikasi Ergonomi Pada Perancangan Meja Batik untuk Meningkatkan Produktivitas dan Mengurangi Keluhan Musculoskeletal Pembatik di Sentra Industri Batik Tulis Tegal 1210BaruStatus usulan:0613047402UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:SRI ADI NURHAYATIStabilitas Emosi Pada Anak Korban Perceraian di Kota Tegal1211BaruStatus usulan:0613027002UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:IRFAN SANTOSA S.T,M.TPEMURNIAN AIR LAUT (DISTILASI) DENGAN SISTEM BASIN SOLAR STILL TIPE HIBRID SEBAGAI ALTERNATIF KEBUTUHAN AIR BERSIH MASYARAKAT PESISIR1212BaruStatus usulan:0621068001UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:AMIRAHSHARIAH COMPLIANCE ANALYSIS:STUDI PADA PERUSAHAAN YANG TERMASUK JAKARTA ISLAMIC INDEX1213BaruStatus usulan:0629118402UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:WIKAN BUDI UTAMIPENGARUH MODEL PEMBELAJARAN INOVATIF TERHADAP KEMAMPUAN MATEMATIKA DAN PEMBENTUKAN JIWA KEWIRAUSAHAAN1214BaruStatus usulan:0627078801UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:GALUH RENGGANI WILISOPTIMALISASI PENGARUH SUDUT KEMIRINGAN COLECTOR SURYA PADA SOLAR WATER HEATER 1215BaruStatus usulan:0625068104UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:152

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARENIE TRI HERDIANI M.Pd.STUDI KASUS TENTANG FOBIA DENGAN PENDEKATAN HIPNOTERAPI1216BaruStatus usulan:0625058301UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:INAYAH ADI SARI M.Si.Analisis Laporan Keuangan, Market Effect, dan Penerapan Good Corporate Governance Sebagai Alat Pendeteksi Dini Potensi Kebangkrutan Bank Dengan Model Regresi Logistik Multinomial1217BaruStatus usulan:0623117801UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:DIAN NATARIA OKTAVIANIPengembangan Modul Geometri Analitik Berbasis Konstruktivisme untuk Meningkatkan Kemampuan Representasi Matematis Mahasiswa Pendidikan Matematika Universitas Pancasakti Tegal1218BaruStatus usulan:0631108501UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:YULIA NUR EKAWATI S.Pd., M.PdPengaruh Penerapan Permainan Tradisional Tegal terhadap Pencapaian Kosakata Bahasa Inggris dan Kemampuan Kerjasama Anak-Anak (Penelitian Eksperimen Pada Siswa Kelas 5 SDN Kudaile 4 Kec. Slawi Kab. Tegal)1219BaruStatus usulan:0628078402UNIVERSITAS PANCASAKTI061013Penelitian Dosen PemulaKode:TJIPTOWATI ENDANG IRIANTI SE., M.Si.INVESMENT OPPORTUNITY SET (IOS) BERBASIS PERTUMBUHAN PERUSAHAAN DAN KAITANNYA DENGAN UPAYA PENINGKATAN NILAI PERUSAHAAN1220BaruStatus usulan:0609066401UNIVERSITAS DARUL ULUM ISLAMIC CENTRE SUDIRMAN061014Penelitian Dosen PemulaKode:SUGIYONO S.Pt MPKUALITAS SILASE RUMPUT TROPIK DENGAN PENAMBAHAN INOKULUM BAKTERI ASAM LAKTAT DARI EKSTRAK RUMPUT TROPIK TERFERMENTASI PADA BERBAGAI SUMBER KARBOHIDRAT YANG BERBEDA 1221BaruStatus usulan:0614016901UNIVERSITAS DARUL ULUM ISLAMIC CENTRE SUDIRMAN061014Penelitian Dosen PemulaKode:YUNI PRIMANDINI SPt, MSiSTRATEGI MANAJEMEN PAKAN AYAM PETELUR PERIODE LAYER DI KAWASAN PERMINYAKAN (STUDI KASUS DI KARYA FARM KECAMATAN CEPU KABUPATEN BLORA)1222BaruStatus usulan:0627068404UNIVERSITAS DARUL ULUM ISLAMIC CENTRE SUDIRMAN061014Penelitian Dosen PemulaKode:Ir. SOLIKHUL HADI M.ErgPENGEMBANGAN POTENSI DESA PILANG KECAMATAN MASARAN KABUPATEN SRAGEN MENUJU KAWASAN DESA WISATA 1223BaruStatus usulan:0603046001UNIVERSITAS ISLAM BATIK061015Penelitian Dosen PemulaKode:153


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAISTIQOMAHANALISIS KEPUASAN PUBLIK ATAS KUALITAS PELAYANAN DI SAT LANTAS POLRES SUKOHARJO1232BaruStatus usulan:0628036201UNIVERSITAS ISLAM BATIK061015Penelitian Dosen PemulaKode:ENDANG MASITOH WAHYUNINGSIHPengaruh Sosialisasi, Tingkat Pemahaman, Motivasi, Kepribadian, Terhadap Penerapan SAK-ETAP di Kampoeng Batik Laweyan Solo1233BaruStatus usulan:0626046201UNIVERSITAS ISLAM BATIK061015Penelitian Dosen PemulaKode:Dra. ENY KUSTIYAH MMBIAS-BIAS KULTURAL DALAM WARNA PUTIH IDEAL1234BaruStatus usulan:0623016201UNIVERSITAS ISLAM BATIK061015Penelitian Dosen PemulaKode:SRI MURYATIPeningkatan Keterampilan Menulis Artikel Melalui Penerapan Active Knowledge Sharing dan Action Learning (Penelitian Tindakan Kelas pada Mahasiswa Semester VI A Progran Pendidikan Bahasa dan Sastra Indonesia Tahun Akademik 2013/2014)1235BaruStatus usulan:0603106201UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:SARI HANDAYANI M.Pd.Analisis Penggunaan Buku Saku Bercakap-cakap Berbahasa Inggris dan Memandu pada Pengemudi Becak dan Pramuniaga di Kampung Wisata Batik Laweyan Surakarta1236BaruStatus usulan:0618048301UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:VERONIKA UNUN PRATIWIKajian Reading dalam Pengajaran Bahasa Inggris bagi Mahasiswa Non Bahasa Inggris di Univet Bantara Sukoharjo1237BaruStatus usulan:0616047404UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:SATRIA AGUNG WIBAWA S.T,M.TPersepsi Masyarakat Terhadap Efektivitas Jembatan Penyeberang ( Studi Kasus Jembatan Penyeberangan Pasar Johar dan Pasar Bulu Semarang )1238BaruStatus usulan:0602017601UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:TRI WIDIATMITINDAK TUTUR DIREKTIF BERBAHASA JAWA DALAM PERCAKAPAN DI KELAS1239BaruStatus usulan:0613026901UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:155

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs. JOKO BEKTI HARYONO M.Pd.Disc Modul Untuk Meningkatkan Pemahaman Konsep Pecahan Bagi Siswa Kelas 5 Sekolah Dasar Negeri 3 Gentan Bendosari Sukoharjo1240BaruStatus usulan:0619095701UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:SUKARYANI M.Si.Kajian Nilai Nutrisi Jerami terfermentasi-MA 11 dengan Lama Pemeraman yang Berbeda1241BaruStatus usulan:0605036101UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:AGUS EFENDISemedi Dalam Kebudayaan Jawa : Studi Kasus Di Tempuran Mantras Mojolaban,Sukoharjo Yang Dihubungkan Dengan Ajaran Sufi1242BaruStatus usulan:0617097503UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:DARSINISistem Perencanaan Persediaan Bahan Baku guna Mencapai Efisiensi Biaya Produksi1243BaruStatus usulan:0608127301UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:MS KHABIBUR RAHMAN S.Pd.,M.Si.Pemetaan Standar Sarana Prasarana Untuk Sekolah Dasar Negeri Berdasarkan Permendiknas Nomor 24 Tahun 2007 di Kecamatan Sukoharjo Kabupaten Sukoharjo Tahun 20141244BaruStatus usulan:0609098601UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:Ir. SITI AKBARI M.PdPENINGKATAN SCIENTIFIC SKILL DAN PRESTASI BELAJAR IPA MELALUI IMPLEMENTASI METODE DISKOVERY BERDASARKAN KURIKULUM 2013 BAGI SISWA KELAS VIIIB SMP MUHAMADIYAH SUKOHARJO1245BaruStatus usulan:0603016201UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:SUPRAPTO ST, M.EngDAYLIGHTING UNTUK PERUMAHAN SEDERHANA1246BaruStatus usulan:0626107001UNIVERSITAS VETERAN BANGUN NUSANTARA061016Penelitian Dosen PemulaKode:VENSY VYDIA S.Kom., M.Kom.Pengaruh Sosial Media Terhadap Komunikasi Interpersonal Dan Cyberbullying Pada Remaja1247BaruStatus usulan:0613087801UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:156

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUBAIDAH RATNA JUITA S.H., M.H.Sistem Pertanggungjawaban Korporasi pada Tindak Pindana Ekonomi ( Suatu Kajian Normatif tentang Kejahatan Perbankan)1248BaruStatus usulan:0614127801UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:SRI HANDAYANI S.T., M.T.Monitoring dan Analisa Traffik di Jaringan USM Menggunakan Multi Router Traffic Grapher1249BaruStatus usulan:0602107202UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:Dra. ROSYATI M.SiPermodelan "UTAUT" Pada UMKM Handycraft Binaan Bank Jateng1250BaruStatus usulan:0615076101UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:WILLYANTO KARTIKO KUSUMOPengaruh independensi dan kompetensi auditor terhadap tanggung jawab auditor dalam mendeteksi kecurangan dan kekeliruan pelaporan keuangan1251BaruStatus usulan:0322027701UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:IIN IRAWATI S.T., M.MT.PERANCANGAN WAKTU SIKLUS ( CYCLE TIME ) PADA SIMPANG BERSINYAL UNTUK MENGURAI KEMACETAN LALULINTAS DENGAN SIMULASI VISSIM1252BaruStatus usulan:0605047704UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:ARI ENDANG JAYATI S.T.Analisa Kinerja Multiple Input Multiple Output (MIMO) dengan Demodulasi Terdistribusi pada Jaringan Sensor Nirkabel 1253BaruStatus usulan:0009028001UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:ANDI KURNIAWAN NUGROHO S.T., M.T.APLIKASI LOGIKA FUZZY UNTUK MENGETAHUI KADAR GAS KARBON MONOKSIDA ( CO ) DAN KARBON DIOKSIDA ( C02 ) SEBAGAI OPTIMASI KUALITAS UDARA1254BaruStatus usulan:0603047601UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:BUDIANI DESTYNINGTIAS S.T., M.Eng.Aplikasi Penggunaan Neural Network untuk Prakiraan Kebutuhan Bahan Bakar PT. Indonesia Power Semarang1255BaruStatus usulan:0605126702UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:157

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATEGUH ARIEFIANTORO S.E., M.M.Pengaruh Networking, Kelengkapan Informasi Pemasaran Terhadap Market Entry Strategy Quality Dalam Upaya Meningkatkan Marketing Performance UMKM Di Semarang1256BaruStatus usulan:0629047401UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:MUFADHOL S.Kom., M.Kom.Penentuan Koordinat Titik Pada Teknologi Garis Dalam Grafika Komputer Dengan Menggunakan Algoritma Line Equation1257BaruStatus usulan:0629017701UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:AMERTI IRVIN WIDOWATI S.E., M.Si., AktHubungan Variabel Demografi Dengan Perilaku Ketidakjujuran Mahasiswa Akuntansi1258BaruStatus usulan:0629038401UNIVERSITAS SEMARANG061017Penelitian Dosen PemulaKode:FERA TRI WULANDARIPerencanaan Strategi Fakultas Menggunakan Metode Fuzzy QSPM1259BaruStatus usulan:0604038601UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:BAYU INDRAYANTO S.S.,M.HumPenyulihan dalam Bahasa Jawa1260BaruStatus usulan:0620068401UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:AFRILIANA KUSUMADEWI S.T., M.Eng.Implementasi Teknik Histogram Equalization untuk Evaluasi Ciri Citra Medis Menggunakan Parameter Karakterisasi Statistik Termal 1261BaruStatus usulan:0011047801UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:UMMU HANY ALMASITOHPENINGKATAN KUALITAS PEMBELAJARAN BERBICARA DENGAN METODE KOOPERATIF DENGAN TEKNIK DESSI (DISKUSI, EKSPRESI, SERANG BALIK DAN SIMPULAN)PADA SISWA SMAN DI KLATEN1262BaruStatus usulan:0616028401UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:TITIK PURWANTI SE. M.Si.CARBONACCOUNTING: IMPLIKASI STRATEGISPEREKAYASAAN AKUNTANSI SEKTOR PUBLIK1263BaruStatus usulan:0605127603UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:158

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJOKO SUNGKONOPengembangan Strategi Pembelajaran Info Search Berbasis PMR Untuk Meningkatkan Pemahaman Materi Mata Kuliah Statistika Dasar 21264BaruStatus usulan:0621028601UNIVERSITAS WIDYA DHARMA061018Penelitian Dosen PemulaKode:SM SANTI WINARSIH S.Kom.,M.Cs.Perancangan Prototipe Perangkat Lunak Expert System Dengan Metode Backward Chaining Untuk Membantu Pemeriksaan Antenatal di Tingkat Pelayanan Dasar1265BaruStatus usulan:0610097101UNIVERSITAS KRISTEN SURAKARTA061020Penelitian Dosen PemulaKode:MUJIYONO SE., M.Si EFEKTIFITAS PEMBERLAKUAN PAJAK PENGHASILAN 1% FINAL BAGI UMKM DI SURAKARTA1266BaruStatus usulan:0619026301UNIVERSITAS KRISTEN SURAKARTA061020Penelitian Dosen PemulaKode:ENDANG SATYAWATI SE.Akt.PENGARUH SELF ASSESSMENT SYSTEM DAN SISTEM INFORMASI PERPAJAKAN TERHADAP KEPATUHAN WAJIB PAJAK1267BaruStatus usulan:0608047201UNIVERSITAS KRISTEN SURAKARTA061020Penelitian Dosen PemulaKode:BASUKI NUGROHO SE., M.SiRELEVANSI DIMENSI EKUITAS MEREK BAGI PENGEMBANGAN PEMASARAN PRODUK UMKM KULINER SOTO KHAS BOYOLALI 1268BaruStatus usulan:0606077001UNIVERSITAS KRISTEN SURAKARTA061020Penelitian Dosen PemulaKode:- SINUNG UTAMI HASRI HABSARI S.SosRepresentasi Perempuan Koruptor Di Media Massa (Analisa Wacana Analisa Wacana Pemberitaan Kasus Angelina Sondakh di Majalah Tempo Sebagai Upaya Mengembangkan Jurnalisme Berperspektif Gender)1269BaruStatus usulan:0602087101UNIVERSITAS PANDANARAN061021Penelitian Dosen PemulaKode:Dra RETNO DJOHAR JULIANI MPdFeature Kekerasan dalam Rumah Tangga1270BaruStatus usulan:0611076101UNIVERSITAS PANDANARAN061021Penelitian Dosen PemulaKode:AGUSTIEN ZULAIDAH MTTEPUNG BUAH MANGROVE TERMODIFIKASISECARA HIDROLISIS ASAM DAN REAKSI PHOTOKIMIA UVSEBAGAI BAHAN SUBSTITUSI GANDUM1271BaruStatus usulan:0624087302UNIVERSITAS PANDANARAN061021Penelitian Dosen PemulaKode:159

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAREKNO SULANDJARI S.Sos, MIKomPERAN PORNOTEKS MEDIA DALAM PEMBENTUKAN PERILAKU SEKSUAL REMAJA1272BaruStatus usulan:0621097103UNIVERSITAS PANDANARAN061021Penelitian Dosen PemulaKode:Drs. SUGIYARMASTO MM.Strategi Penerapan Total Quality Management (TQM) Pada Keberhasilan Pendidikan Tinggi Swasta di Surakarta1273BaruStatus usulan:0620036302UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:EDY PRASETYAProduksi pupuk urin manusia yang diperkaya Bakteri Pelarut Fosfat, Azotobacter, Rummino bacillus dan jamur Aspergillus niger pada tanaman pangan 1274BaruStatus usulan:0605055701UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:IFANDARIISOLASI BAKTERI PENGHASIL POLI-β-HIDROKSI BUTIRAT (PHB) DARI LIMBAH CAIR TAPIOKA1275BaruStatus usulan:0605028302UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:SITI AISIYAHPEMANFAATAN LIMBAH LAPISAN PUTIH KULIT SEMANGKA (Citrullus vulgaris, Schrad)DALAM PEMBUATAN KRIM TABIR SURVA SEBAGAI ANTIOKSIDAN YANG DIUJI SECARA IN VITRO DENGAN DPPH1276BaruStatus usulan:0601057801UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:DEWI EKOWATIAntihiperkolesterolemia dari kapsul kombinasi ekstrak daun jati belanda (Guazuma ulmifolia L) dan kelopak bunga rosella (Hibiscus sabdarifa L)1277BaruStatus usulan:0618057801UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:MARIA ENDAH PRASADJA ST., MTKajian Aplikasi Proses Klorinasi Untuk Menurunkan Kadar Sianida Dalam Limbah Cair Tapioka Berdasarkan Potensi Pembentukan Tri Halo Metana 1278BaruStatus usulan:0613056703UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:VIVIN NOPIYANTIPENGARUH KADAR FLAVONOID DAN FENOLIK TOTAL FRAKSI EKSTRAK DAUN ROSELLA (Hibiscus sabdariffa L.)TERHADAP PENINGKATAN AKTIVITAS ANTIOKSIDAN 1279BaruStatus usulan:0618088102UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:160

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERNI SUPARTIDesign Alat Pemisah Kulit Ari Kedelai Setelah Pengelupasan pada Industri Tempe dengan Metode Quality Function Deployment1280BaruStatus usulan:0607118404UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:GURUH SRI PAMUNGKAS S.Pt.,M.SiPengaruh Klorinasi Limbah Cair Tapioka Terhadap Pertumbuhan Bakteri Pseudomonas Dalam Proses Aerasi Lumpur Aktif 1281BaruStatus usulan:0607028403UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:OPSTARIA SAPTARINI M.Si., Apt.Pemanfaatan seduhan akar wangi sebagai Bahan Obat Tradisional untuk Mengatasi Sariawan yang Disebabkan Jamur Candida albicans1282BaruStatus usulan:0619097902UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:LUCIA VITA INANDHA DEWIPOTENSI KULIT BATANG MUNDU (Garcinia dulcis Kurz) DAN KULIT MANGGIS (Garcinia mangostana) SEBAGAI HEPATOPROTEKTOR1283BaruStatus usulan:0616107802UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:PETRUS DARMAWAN S.T., M.T. Aktifasi Zeolit sebagai Adsorben Logam Berat Krom Industri Batik di Surakarta 1284BaruStatus usulan:0603117302UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:Dra. PUDIASTUTI RAHAYU SP MM,Apt.FORMULASI GEL KOMBINASI LENDIR BEKICOT (Achatina fulica Ferr) DAN LIDAH BUAYA SEBAGAI MATERIAL AKTIF UNTUK PENGOBATAN LUKA BAKAR 1285BaruStatus usulan:0619045302UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:ISMI RAHMAWATI M.Si., Apt.Kajian Senyawa 2,6-Bis-(2-furilidin)sikloheksanon Sebagai Kandidat Obat Antibakteri untuk Mengatasi Bakteri yang Resisten1286BaruStatus usulan:0616117405UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:SAMUEL BUDI HARSONO LOMANTOANALISIS PENGGUNAAN PASIEN SKIZOPRENIA DI RUMAH SAKIT JIWA DAERAH SURAKARTA TAHUN 20131287BaruStatus usulan:0627118002UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:161

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAINARATUL RIZKHY HANIFAHPEMANFAATAN DAUN BELIMBING WULUH DALAM BENTUK INFUSA DAN SEDIAAN CELUP (Averrhoa bilimbi L) TERHADAP PENURUNAN BERAT BADAN 1288BaruStatus usulan:0623088703UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:IKA PURWIDYANINGRUMUji Aktivitas Diuretik Ekstrak Daun Matoa (Pometia pinnata) Pada Tikus Jantan Galur Wistar1289BaruStatus usulan:0631038502UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:TITIEK PUJI ASTUTISTUDI EMPIRIS KEPATUHAN PAJAK DALAM PEMBAYARAN PAJAK BUMI DAN BANGUNAN PEDESAAN DAN PERKOTAAN KABUPATEN SUKOHARJO1290BaruStatus usulan:0623117704UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:Dra. LINA SUSANTI M.Si.PEMANFAATAN MINYAK ATSIRI DAUN ROSMARIN(Rosmarinus officinalis L) TERHADAP LARVA NYAMUK Culex Quinquefasciatus SEBAGAI VEKTOR FILARIASIS (PENYAKIT KAKI GAJAH)1291BaruStatus usulan:0627054601UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:DEWI SULISTYAWATIPotensi Antimikrobia dari Lima Jenis Ekstrak Tumbuhan 0bat terhadap Bakteri Mycobacterium tubercolusis1292BaruStatus usulan:0626106601UNIVERSITAS SETIA BUDI SURAKARTA061022Penelitian Dosen PemulaKode:AGUS SETYAWANPengaruh Panjang Serat Pada Komposit Serat Serabut Kelapa-Semen Gypsum Terhadap Kekuatan Bending dan Tarik Sebagai Bahan Les Plang Ramah Lingkungan1293BaruStatus usulan:0601086901UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:EDY SUSILO WIDODOKINERJA MOTOR BAKAR BENSIN SATU SILINDER 4 TAK DENGAN VARIASI BOBOT TORAK 1294BaruStatus usulan:0611036902UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:WIJOYO M.EngRekayasa Komposit Sandwich Serat Aren-Polyester dengan Core Gedebog Pohon Pisang terhadap Kekuatan Bending1295BaruStatus usulan:0612017401UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:162

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAKUN ISMAWATIFaktor-faktor yang Mempengaruhi Entrepreneurship Decision Making Calon Sarjana Ekonomi di Surakarta1296BaruStatus usulan:0613077703UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:ST SILVIA YULITA RATIH SETYO RAHA MTPengaruh Fraksi Volume Batubata Dengan Material Penguat Serbuk Gergaji Kayu Sengon Laut Terhadap Kuat Uji Bending1297BaruStatus usulan:0630077601UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:ST EKO SURJADI M.EngUJI PERFORMA TUNGKU GASIFIKASI MODEL CROSS DRAFT UNTUK KEPERLUAN RUMAH TANGGA SEBAGAI UPAYA MEMPERBAIKI KINERJA TUNGKU GASIFIKASI MODEL TOP LIT DOWN DRAFT1298BaruStatus usulan:0626127101UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:ASRI AGUSTIWIKAJIAN TERHADAP PERAN PEJABAT PEMBUAT AKTA TANAH MENURUT PERATURAN PEMERINTAH NOMOR 24 TAHUN 1997 TENTANG PENDAFTARAN TANAH( Studi Kasus Di Kantor Notaris Dan PPAT IMMAWATI USWATUN CHASANAH, S.H., M.Kn )1299BaruStatus usulan:0628088202UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:ACHMAD NURHIDAYATPENGARUH FRAKSI VOLUME SERAT CANTULA TERHADAP KETANGGUHAN IMPAK KOMPOSIT CANTULA-HDPE DAUR ULANGSEBAGAI BAHAN CORE LANTAI RAMAH LINGKUNGAN1300BaruStatus usulan:0626027202UNIVERSITAS SURAKARTA061024Penelitian Dosen PemulaKode:ARIF SUSANTOPengelolaan Limbah Minyak Pelumas Bengkel Kendaraan Bermotor Konsep Kesadaran Diri1301BaruStatus usulan:0606088301UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:NASRUDINPENGEMBANGAN MODEL PENDIDIKAN KARAKTER BERDASARKAN SIFAT FITRAH MANUSIA 1302BaruStatus usulan:0602057706UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:MURRY HARMAWAN SAPUTRAStrategi Retail Mix Untuk Meningkatkan Daya SaingPeritel di Pasar Tradisional1303BaruStatus usulan:0617038004UNIVERSITAS MUHAMMADIYAH PURW OREJO061025Penelitian Dosen PemulaKode:163

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADYAH PANUNTUN UTAMIPERILAKU KONSUMSI PANGAN LOKAL MENDUKUNG PENCAPAIAN DIVERSIFIKASI PANGAN 1304BaruStatus usulan:0603017501UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:NILA KURNIASIHPENGEMBANGAN MEDIA KARTUN MATEMATIKA YANG EFEKTIF UNTUK MENINGKATKAN MINAT DAN PRESTASI BELAJAR SISWA SEKOLAH MENENGAH PERTAMA1305BaruStatus usulan:0613117501UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:BUDI SETIAWAN S.Sos., M.Si.Model Pembelajaran Ilmu Sosial Dasar Online Berbasis Wiki untuk Meningkatkan Pola Berfikir Kritis Mahasiswa1306BaruStatus usulan:0616097501UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:TUSINOKONTRIBUSI MEDIA WAYANG KULIT SEBAGAI MEDIA ALTERNATIVE UNTUK MENINGKATKAN KEMAMPUAN BAHASA INGGRIS BERBASIS KEARIFAN LOKAL1307BaruStatus usulan:0616088201UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:YULI WIDIYONOPengembangan Multimedia Wayang di SMA Berbasis Pendidikan Karakter1308BaruStatus usulan:0616078301UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:RIAWAN YUDI PURWOKOPengembangan Lembar Kerja Siswa (LKS) Matematika Realistik di SMP berbasis Online Interaktif1309BaruStatus usulan:0619098503UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:SUYOTOPengembangan Multimedia Pembelajaran Matematika Berbasis Multiple Intelligences1310BaruStatus usulan:0606058403UNIVERSITAS MUHAMMADIYAH PURWOREJO061025Penelitian Dosen PemulaKode:NURHIDAYATIEfektivitas Model Pembelajaran Problem Based Instruction terhadap Regulasi Diri dan Konsep Diri Mahasiswa1311BaruStatus usulan:0618118102UNIVERSITAS MUHAMMADIYAH PURW OREJO061025Penelitian Dosen PemulaKode:164


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMARIYAMPenggunaan madu dalam oral hygiena sebagai inhibitor koloni bakteri pada anak yang dirawat di PICU rumah sakit wilayah kota Semarang1320BaruStatus usulan:0601048101UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:TESTIANA DENI WIJAYATININGSIHSTUDI KOMPARASI ANTARA DEMONSTRATION DAN DISCUSSION PADA PENGUASAAN KEMAMPUAN MENULIS MAHASISWA1321BaruStatus usulan:0608058401UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:DEWI PUSPITANINGRUMPerbedaan Pengetahuan Remaja Sebelum dan Sesudah Dilakukan Penyuluhan Tentang Pencegahan Seks Bebas di Sekolah Menengah Kejuruan Negeri 6 Semarang1322BaruStatus usulan:0605068401UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:ERNAWATIANALISIS KEBUTUHAN PERAWATAN DI RUMAH UNTUK PENDERITA HIV/AIDS 1323BaruStatus usulan:0605117602UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:Drs ROHMAT SUPRAPTO MSIDERADIKALISASI AGAMA MELALUI PENDIDIKAN MULTIKULTURAL-INKLUSIVISME1324BaruStatus usulan:0603027502UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:FITRIANI NUR DAMAYANTIPERBEDAAN PENGARUH PENDIDIKAN KESEHATAN DENGAN METODE CERAMAH DIBANDINGKAN BOOKLET TERHADAP PENGETAHUAN, SIKAP DAN PERILAKU PENCEGAHAN KANKER PAYUDARA (CA MAMMAE) PADA WANITA USIA SUBUR DENGAN PEMERIKSAAN SADARI DI PUSKESMAS KEDUNGMUNDU KOTA SEMARANG TAHU1325BaruStatus usulan:0618058802UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:RIWAYATIEfektifitas Psikoedukasi Terhadap Kemampuan Keluarga Merawat Anggota Keluarga Penderita HIV-AIDS Di Wilayah Kota Semarang1326BaruStatus usulan:0618036402UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:MACHMUDAHKomposisi Kimia ASI pada Ibu Postpartum yang Dilakukan Pijat Payudara dengan Metode Oketani di Rumah Sakit Roemani Semarang1327BaruStatus usulan:0015127201UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:166

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAMIN SAMIASIHPENURUNAN RISIKO PENYAKIT JANTUNG KORONER PADA AKSEPTOR KB SUNTIK DMPA DENGAN BEKAM BASAH (INDIKATOR TRIGLISERID)1328BaruStatus usulan:0605107202UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:DIANA HARDIYANTIPenerjemahan Kosa Kata Budaya Indonesia Dalam Rubrik Life Lines di harian The Jakarta Post 1329BaruStatus usulan:0601127703UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:EKO ANDY PURNOMOPengembangan Perangkat Pembelajaran dengan Model Ideal Problem Solving Berbasis Maple Matakuliah Kalkulus II1330BaruStatus usulan:0609058501UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:MOCHAMMAD TONI PRASETYOEfektifitas Pemanfaatan Pasir Pantai Berkalsium Tinggi Sebagai Material Pengisi Bahan Isolasi Resin Epoksi Untuk Isolator Listrik1331BaruStatus usulan:0628057203UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:SRI WIDODOPeningkatan Oksigenasi Jaringan pada Penderita Hiperkolesterolemia yang Mendapatkan Terapi Bekam Basah di Klinik Bekam Center Semarang(Kajian Kadar Hemoglobin Darah dan Saturasi Oksigen)1332BaruStatus usulan:0620117203UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:SOLECHANPemanfaatan Tulang Sapi Dari Limbah Bakso Balungan Untuk Pembuatan Scaffold Bovine Hydroxyapatite Pada Implan Tulang Mandibula1333BaruStatus usulan:0629048101UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:Ns TRI NURHIDAYATI S.Kep.,M.MedEdPeran Keluarga Buruh Migran Internasional pada pengasuhan anak ditinjau dari perspektif psikososial di Wilayah Kabupaten Kendal1334BaruStatus usulan:0628107802UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:ANDRI SUKEKSI SKM, M.SiAnalisis Similaritas Nyamuk Aedes sp Isolat Kendal berbasis Sidik Jari Total Protein Terlarut Untuk Melacak Epidemiologi Demam Berdarah Dengue 1335BaruStatus usulan:0624076301UNIVERSITAS MUHAMMADIYAH SEMARANG061026Penelitian Dosen PemulaKode:167



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAVERONICA LUSIANA S.T,M.KomRekayasa Keamanan Lapiran Surat Elektronik (E-Mail) Menggunakan Kunci Publik dan Privat1352BaruStatus usulan:0603047603UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:ACHMAD BADJURI SE, MSi, AkRole Stres Sebagai Moderating Variable Dalam Hubungan Antara Komitmen Organisasi Dengan Kepuasan Kerja Auditor (Studi Empirik Pada Kantor Akuntan Publik Di Semarang)1353BaruStatus usulan:0611117601UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:IDA NURHAYATIAnalisis Pengaruh Faktor Internal Sebagai Pemicu Terjadinya Turnover Intentions (Studi Kasus Karyawan Kantor Konsultan Pajak di Semarang)1354BaruStatus usulan:0617046802UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:SUNARDI S.Kom., M.Cs.VISUALISASI INFORMASI KEMAJUAN BELAJAR MAHASISWA UNTUK SARANA MONITORING PROSES BELAJAR MENGAJAR YANG EFEKTIF1355BaruStatus usulan:0624046803UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:AGUS MURDIYANTO S.E., M.M.Analisis Peningkatan Kapasitas Ketrampilan, MOdal Pinjaman dan Kolektabilitas Pinjaman (Studi kasus pada PNPM Mandiri Kecamatan Gemuh Kabupaten Kendal)1356BaruStatus usulan:0631086601UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:SRI RAHAYUNINGSIH S.E., M.M.ANALISIS UPAYA PENINGKATAN PENDAPATAN RUMAH TANGGA MISKIN KELOMPOK PENGRAJIN BATIK DENGAN CANTING ELEKTRIK (Studi Empirik pada Kelompok Pengrajin Batik di Kecamatan Gunung Pati Semarang)1357BaruStatus usulan:0627126101UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:MUJI SUKUR S.Kom., M.Cs.MODEL SISTEM INOVASI PERTANIAN BERBASIS IT DENGAN TEKNOLOGI MOBILE1358BaruStatus usulan:0627017201UNIVERSITAS STIKUBANK061029Penelitian Dosen PemulaKode:IKA PURNAMASARI S.Kep.POLA TATA LAKSANA PASIEN DIARE CAIR AKUTDI RSUD WONOSOBO1359BaruStatus usulan:0614048101UNIVERSITAS SAINS ALQUR AN061030Penelitian Dosen PemulaKode:170


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAPUJI LAKSONO M.HumMETODE MASYARAKAT JAWA DALAM MENJAGA KEBERLANGSUNGAN KEKERABATANNYA ( STUDI KASUS BANI SANRAJI DI MAGELANG )1368BaruStatus usulan:0630117501UNIVERSITAS SAINS ALQUR AN061030Penelitian Dosen PemulaKode:NGATINDRIATUNADAPTASI MODEL PEMBERDAYAAN INDUSTRI BATIK RAMAH LINGKUNGAN DI JAWA TENGAH GUNA PERCEPATAN DAN PENGUATAN PEMBANGUNAN EKONOMI PADA SEKTOR INDUSTRI TEKSTIL DI INDONESIA1369BaruStatus usulan:0617036501UNIVERSITAS DIAN NUSW ANTORO061031MP3EIKode:MARYANI SETYOWATIPemetaan Cakupan Status Gizi Balita Berbasis Wilayah dalam Mendukung Keberhasilan Pencapaian Millenium Development Goals (MDGs) tahun 2015 di Wilayah Kota Semarang1370BaruStatus usulan:0604037501UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:KHAFIIZH HASTUTISISTEM INFORMASI PENGELOLAAN DOKUMEN TANGIBLE CULTURAL HERITAGE1371BaruStatus usulan:0604097902UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:SUPRIYONO ASFAWI SE, M.KesDampak Usaha Laundry Terhadap Tingkat Pencemaran Air.Studi Kasus di Kelurahan Pindrikan Kidul.1372BaruStatus usulan:0603087002UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:AYU PERTIWI S.Kom., MT.Penentuan Variabel Lokasi Jarak Ritel Modern dengan Pasar Tradisional menggunakan Metoda Agile Berbasis Geographics Information System (GIS)1373BaruStatus usulan:0613116801UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:RICARDUS ANGGI PRAMUNENDARPenentuan Kualitas Kayu Kelapa Berbasis Citra Digital Menggunakan Jaringan Syaraf Tiruan dan Algoritma Genetika1374BaruStatus usulan:0613068601UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:MUSLIHDESAIN ARSITEKTUR DATABASE SECARA REAL-TIME ANTAR DATABASE HETEROGEN UNTUK MENGELOLA INTEGRASI DATA ANTAR DATABASE EPIDEMIOLOGI 1375BaruStatus usulan:0604057501UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:172

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAENNY SUSILOWATI MARDJONOModel Kompetensi Kewirausahaan dengan Adaptibilitas Lingkungan Bisnis dan Kreativitas Inovasi Unit Usaha Kecil dan Menengah di Semarang1376BaruStatus usulan:0604057802UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:FAJAR AGUNG NUGROHODESAIN FRAMEWORK MULTIMEDIA QUEUEING SYSTEM BERBASIS ANDROID SEBAGAI USULAN STANDARISASI LAYANAN PUSKESMAS1377BaruStatus usulan:0611048402UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:YULITA SETIAWANTA S.E, M.Si.Pengunaan karakter Informativenes, Information Format, easy to Use, Timeliness dan Reliability untuk Mengukur Kinerja Sistem Informasi : Kajian Persepsi Pemakai pada Sistem Informasi Akademik (Studi Kasus Persepsi Mahasiswa Fak. Ekonomi dan Bisnis PTS di 1378BaruStatus usulan:0608077001UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:CAHAYA JATMOKOSISTEM PEMANTAU PERTUMBUHAN POHON DI AREA HUTAN PENAMPUNG AIR TANAH DENGAN MENGGUNAKAN SISTEM INFORMASI GEOGRAFIS (GIS) DI WILAYAH PROPINSI JAWA TENGAH1379BaruStatus usulan:0614027402UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:AJIB SUSANTO M.Kom.REKAYASA E-MARKET UNTUK KELOMPOK USAHA PEMUDA BINAAN DINAS PEMUDA DAN OLAHRAGA PROPINSI JAWA TENGAH SEBAGAI UPAYA PENINGKATAN PEMASARAN DAN PENJUALAN PRODUK UMKM1380BaruStatus usulan:0615127404UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:ERWIN YUDI HIDAYATSistem Legalisir Scan Ijazah Online Berbasis QR Code dan Watermarking1381BaruStatus usulan:0605078501UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:VALENTINA WIDYA SURYANINGTYASKualitas Keberterimaan Sastra Anak dalam Portal Online1382BaruStatus usulan:0616098304UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:LILIS SETYOWATIDampak Peranan Teknologi Sistem Informasi Akuntansi Keuangan Daerah, Pemahaman Akuntansi dan Kompetensi Sumber Daya Manusia, Serta Peran Internal Audit Terhadap Kualitas Laporan Keuangan Daerah Pada Pemerintah Kota Semarang1383BaruStatus usulan:0607018703UNIVERSITAS DIAN NUSW ANTORO061031Penelitian Dosen PemulaKode:173




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs. NGUBAIDI ACHMAD M.PdKetahanan Membaca Guru Sekolah Menengah Kejuruan (SMK) Teknik Mesin Otomotif di Kota Semarang1408BaruStatus usulan:0011025601IKIP VETERAN JAWA TENGAH062001Penelitian Dosen PemulaKode:FUAD ABDILLAH ST, MTPembuatan Prototipe Alat Penghemat Bahan Bakar Mobil Dari Limbah Pipa Tembaga Menggunakan Metode Hydrocarbon Crack System Dengan Memanfaatkan Uap Bahan Bakar1409BaruStatus usulan:0604127301IKIP VETERAN JAWA TENGAH062001Penelitian Dosen PemulaKode:Dra. ZUSROTIN M.PdStudi Eksplorasi tentang Violence Awareness pada Mahasiswa : Upaya Pencegahan Tindak Kekerasan Pada Wanita dan Anak1410BaruStatus usulan:0623075601IKIP VETERAN JAWA TENGAH062001Penelitian Dosen PemulaKode:JOKO SUWIGNYO STPemanfaatan Elektrolisis Sebagai Alternatif Suplemen Bahan Bakar Motor Disel Untuk Mengurangi Polusi Udara1411BaruStatus usulan:0627037201IKIP VETERAN JAWA TENGAH062001Penelitian Dosen PemulaKode:HENY KURNIANINGSIH SE., MMAnalisis Penerimaan Teknologi Perpustakaan Digital pada Perpustakaan Perguruan Tinggi Swasta di Kabupaten Sukoharjo.1412BaruStatus usulan:0615037501SEKOLAH TINGGI ILMU EKONOMI SURAKARTA063004Penelitian Dosen PemulaKode:ROSITA S.E., M.M., Ak.ANALISIS SISTEM INFORMASI AKUNTANSI PADA KOPERASI YANG SESUAI DENGAN SAK ETAP1413BaruStatus usulan:0020067501SEKOLAH TINGGI ILMU EKONOMI SURAKARTA063004Penelitian Dosen PemulaKode:HANDAYANI TRI WIJAYANTI S.E., M.SiEVALUASI KINERJA PELAYANAN DAN KINERJA KEUANGAN RUMAH SAKIT UMUM DAERAH YANG MENERAPKAN POLA PENGELOLAAN KEUANGAN BADAN LAYANAN UMUM DAERAH DI SUBOSUKOWONOSRATEN1414BaruStatus usulan:0010127901SEKOLAH TINGGI ILMU EKONOMI ATMA BHAKTI063006Penelitian Dosen PemulaKode:SITI ALMAIDAH S.E., M.MPengaruh Komitmen Organisasi, Perilaku Kewargaan Organisasional, Dan Etika Kerja Islami Terhadap Perubahan Organisasi (Studi terhadap Dosen Perguruan Tinggi Swasta di Surakarta)1415BaruStatus usulan:0709046903SEKOLAH TINGGI ILMU EKONOMI ATMA BHAKTI063006Penelitian Dosen PemulaKode:177

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAPIJI PAKARTI SE, MSi.GAYA HIDUP, SIKAP TERHADAP UANG, DAN KEPUTUSAN PEMBELIAN PADA WANITA PEKERJA SEKTOR FORMAL1416BaruStatus usulan:0613097002SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:SETYO PANTAWIS SE, MM.Analisis Brand Switching Social Media1417BaruStatus usulan:0615096701SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:MEKANI VESTARI SE, MSi. Akt.Pengaruh Budaya, Peran dalam Rumah Tangga, Transportasi, dan Akses yang Rendah Akan Sumber Daya terhadap Keberhasilan Penerapan Program Peningkatan Peran Wanita Menuju Keluarga Sehat dan Sejahtera (P2WKSS).1418BaruStatus usulan:0016077401SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:ALI MURSID SS, MM.Keunggulan Bersaing dan Kinerja Industri Kreatif Dari Perspektif Kewirausahaan, Kemampuan Pemasaran dan Inovasi (Penelitian Terhadap Sektor Industri Kreatif di Kota Semarang)1419BaruStatus usulan:0623076901SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:DESSY NOOR FARIDA SE, MSi., Ak.Pengaruh Dewan Komisaris Independen Dan Kepemilikan Manajerial Terhadap Kualitas Laba Dengan Moderasi Konsentrasi Kepemilikan Keluarga1420BaruStatus usulan:0622127901SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:Drs. HERY PRASETYA MM.Peningkatan Daya Saing UKM Melalui Standarisasi Produk, Pengelolaan Pengetahuan dan Teknologi Informasi (Studi pada UKM Pengecoran Logam di Ceper - Klaten)1421BaruStatus usulan:0627026701SEKOLAH TINGGI ILMU EKONOMI BANK BPD JAW A TENGAH063013Penelitian Dosen PemulaKode:FITRI ELLA FAUZIAHPengaruh Corporate Social Responsibility Terhadap kualitas laba dengan Corporate Governance Sebagai variabel Moderating1422BaruStatus usulan:0024058201SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:MIFTAH ARIFIN SH., MH.Pengawasan DPRD Terhadap Pelaksanaan Peraturan Daerah Tentang Anggaran Pendapatan dan Belanja Daerah Kota Jepara Tahun 20131423BaruStatus usulan:0614097301SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:178

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADWI AGUNG NUGROHO ARIANTOPENGARUH USIA, PENDIDIKAN, DAN BUDAYA TERHADAP KEPATUHAN LALU LINTAS DI WILAYAH HUKUM POLRES JEPARA1424BaruStatus usulan:0620017801SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:MURHARSITOPengaruh Cadangan Devisa dan Nilai Tukar Terhadap Penularan Goncangan Keuangan Dari Bank Multinasional ke Negara Berkembang1425BaruStatus usulan:0010048101SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:ANNA WIDIASTUTI S.E., M.Si.Pengaruh Pengetahuan Dan Kebijakan Pimpinan Terhadap Penerapan Akuntansi Syariah Di BMT Se Kabupaten Jepara1426BaruStatus usulan:0602107401SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:DJUHONO TPengujian Kesuksesan Sistem Informasi Keuangan Daerah (SIMKEDA) Kab. Jepara1427BaruStatus usulan:0603127101SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:ICHWAN MARISANPenelitian Survei Penerapan Prinsip-Prinsip Koperasi pada Koperasi Simpan Pinjam di Kab. Jepara1428BaruStatus usulan:0603075903SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:MUHAMMAD RIDHOKEMAMPUAN RASIO-RASIO KEUANGAN DALAM MEMPREDIKSI PERINGKAT OBLIGASI (PT. KASNIC CREDIT RATING)1429BaruStatus usulan:0602098001SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:ALI SOFWANAnalisis Penentuan Harga Jual Berdasarkan Prinsip Murabahah Pada Baitul Maal Wat Tamwil (BMT) di Kabupaten Jepara1430BaruStatus usulan:0609017301SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:SETYO UTOMO SE.M.Si.PERSEPSI MASYARAKAT TERHADAP BAITUL MAAL WAT TAMWIL (BMT) DALAM PEMBERDAYAAN EKONOMI LOKAL (STUDI PADA BMT SE-KOTA JEPARA)1431BaruStatus usulan:0601016402SEKOLAH TINGGI ILMU EKONOMI NAHDLATUL ULAMA`063015Penelitian Dosen PemulaKode:179




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASITI ALLIYAHPENINGKATAN KINERJA UKM DENGAN MENGIMPLEMENTASIKAN INFORMASI AKUNTANSI MANAJEMEN YANG DIDUKUNG OLEH INFORMASI ANTAR UNIT1456BaruStatus usulan:0612068202SEKOLAH TINGGI ILMU EKONOMI YPPI063031Penelitian Dosen PemulaKode:SRI LAYLA WAHYU ISTANTI S.E., M.Si.PERANAN INTELLECTUAL CAPITAL UNTUK MENINGKATKAN KINERJA PEMERINTAH DAERAH KABUPATEN REMBANG1457BaruStatus usulan:0624047702SEKOLAH TINGGI ILMU EKONOMI YPPI063031Penelitian Dosen PemulaKode:SUWARMIPembuatan Sediaan Krim Tabir Surya dari ekstrak sarang semut (Myrmedia pendens) dan buah carica1458BaruStatus usulan:0607017001SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:KYKY HERLYANTIPengaruh Kombinasi Ekstrak Terpurifikasi Herba Artemisia (Artemisia annua L.) dan Herba Sambiloto (Andrographis paniculata (Burm.f) Nees) Terhadap Kadar Glukosa Darah pada Tikus Diabetes Mellitus Tipe 2 Resisten Insulin1459BaruStatus usulan:0616068401SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:INTAN MARTHA CAHYANIEFEK PEMBERIAN GLUKOMANAN UMBI PORANG (Amorphophallus oncophyllus) TERHADAP PARAMETER HEPAR TIKUS PUTIH JANTAN GALUR WISTAR YANG DIINDUKSI PARASETAMOL1460BaruStatus usulan:0605038301SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:MUTMAINAHUji Aktifitas Gel Ekstrak Etanol Kulit Buah Manggis (Garcinia mangostana L.) Sebagai Penyembuh Luka Bakar Pada Kulit Punggung Kelinci1461BaruStatus usulan:0602078403SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:RIRIN SUHARSANTISTANDARISASI EKSTRAK DAUN SOM JAWA UNTUK MENJAMIN MUTU PENGGUNAAN SEBAGAI OBAT HERBAL ANTIKEPUTIHAN 1462BaruStatus usulan:0601048601SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:BEKTI NUGRAHENIEFEK PEMBERIAN GLUKOMANAN UMBI PORANG (Amorphophallus oncophyllus) TERHADAP KADAR KOLESTEROL TOTAL DAN TRIGLISERIDA DARAH TIKUS PUTIH JANTAN GALUR WISTAR YANG DIBERI DIET LEMAK TINGGI1463BaruStatus usulan:0610108401SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:183

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAALOYSIUS BARRY ANGGOROPEMANFAATAN EKSTRAK ETANOL DAUN SOM JAWA SEBAGAI OBAT ANTISEPTIK DALAM SEDIAAN GEL ANTISEPTIK KULIT1464BaruStatus usulan:0611047903SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:Dra. ERLITA VERDIA MUTIARA M.Si., Apt.Ekstraksi Flavonoid dari Daun Pare (Momordica charantia L.) Berbantu Gelombang Mikro Sebagai Penurun Kadar Glukosa Secara In Vitro1465BaruStatus usulan:0613096402SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:ERNA PRASETYA NINGRUMPEMANFAATAN EKSTRAK ETANOL DAUN SOM JAWA SEBAGAI OBAT HERBAL ANTIKEPUTIHAN DALAM SEDIAAN SABUN CAIR1466BaruStatus usulan:0608118501SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:IKA PUSPITANINGRUMPembuatan Tepung Umbi Kimpul (Xamthosoma violacheum Chott.) dan Pemanfaataannya sebagai Antidiabetes Militus Tipe II1467BaruStatus usulan:0025108201SEKOLAH TINGGI ILMU FARMASI YAYASAN PHARMASI063032Penelitian Dosen PemulaKode:SRI SISWANTI S.Kom, M.KomAnalisa Pengaruh Matakuliah Riset Teknologi Informasi Terhadap Penulisan Skripsi dan Tugas akhir Mahasiswa STMIK Sinar Nusantara1468BaruStatus usulan:0615057201STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:BAMBANG SATRIONUGROHOAnalisa Pengaruh Matakuliah Kewirausahaan Terhadap Minat wirausaha Mahasiswa STMIK Sinar Nusantara1469BaruStatus usulan:0605057901STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:SRI HARIYATI FITRIASIH S.Kom., M.KomHubungan Keaktifan Lansia dan Kader Dengan Status Gizi Dalam Kegiatan Posyandu Untuk Menunjang Sistem Informasi Pemantauan Kesehatan1470BaruStatus usulan:0618097602STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:YUSTINA RETNO WAHYU UTAMI S.T., M.CsPERBANDINGAN UNJUK KERJA METODE SUPPORT VECTOR MACHINE DENGAN LEARNING VECTOR QUANTIZATION PADA APLIKASI PENGENALAN WAJAH1471BaruStatus usulan:0023037801STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:184

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASURYATI GALUH PRAVITASARI S.Pd., M.HumPengaruh Penggunaan Mind Map dalam Pembelajaran Bahasa Inggris III terhadap Skor TOEFL Mahasiswa STMIK Sinar Nusantara Surakarta1472BaruStatus usulan:0601017704STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:TRI IRAWATI SE, M.SiANALISA PENGGUNAAN APLIKASI DALAM PENYUSUNAN LAPORAN KEUANGAN PADA UMKM(STUDI KASUS UMKM KOTA SURAKARTA)1473BaruStatus usulan:0624097402STMIK SINAR NUSANTARA063040Penelitian Dosen PemulaKode:AGUNG NUGROHO S.Kom.DIGITAL AUDIO WATERMARKING (DAW) :SEBAGAI TEKNOLOGI PELINDUNG HAKI MULTIMEDIA1474BaruStatus usulan:0615047503STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:DIYAH RUSWANTI S.Kom.Aplikasi Pengingat Tumbuh Kembang Anak Balita Berbasis WAP1475BaruStatus usulan:0027018101STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:SUTARIYANI S.Kom.Sistem Pendukung Keputusan posisi pemain dalam olahraga sepak bola menggunakan metode AHP1476BaruStatus usulan:0608057901STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:BUDHI SUMBOROMODEL FILM ANIMASI DALAM MEMBANGUN KARAKTERSOSIAL ANAK USIA DINI1477BaruStatus usulan:0611038202STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:HERIBERTUS ARY SETYADIIMPLEMENTASI SISTEM MANAJEMEN PENGETAHUAN UNTUK DISTRIBUSI BANTUAN LOGISTIK KORBAN BENCANA ALAM1478BaruStatus usulan:0601037104STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:WISNU WENDANTORancang Bangun Anjungan Informasi Digital Terintegrasi Berbasis Content Management System di STIE AUB Surakarta1479BaruStatus usulan:0620087703STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:185

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATITA UMI KALSUMPEMANTAUAN PENINGKATAN KEMAMPUAN PENGENALAN HEWAN BERKAKI EMPAT DENGAN PROGRAM PEMBELAJARAN INTERAKTIF BAGI SISWA AUTIS 1480BaruStatus usulan:0628087801STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:PARYANTASISTEM PENDUKUNG KEPUTUSAN UNTUK MENENTUKANMITRA KERJA MENGGUNAKAN METODE PROMETHEEPADA OUTDOOR EVENT ORGANIZER1481BaruStatus usulan:0621046905STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:AGUNG KOES INDARTORANCANG BANGUN SISTEM INFORMASI ADMINISTRASI SPBU DAN UPAH KARYAWAN 1482BaruStatus usulan:0621128104STMIK AUB SURAKARTA063042Penelitian Dosen PemulaKode:EDDY PRIYADI SEPenentuan Kepuasan Pasien Rawat Inap Rumah Sakit Umum Daerah Dengan Metode Logika Fuzzy (Studi Kasus RSUD Kraton Pekalongan)1483BaruStatus usulan:0615056601STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:- PRASTUTI SULISTYORINI M.KomEVALUASI TATA KELOLA TEKNOLOGI INFORMASI MENGGUNAKAN KERANGKA KERJA COBIT DALAM MENDUKUNG LAYANAN SISTEM INFORMASI AKADEMIK (STUDI KASUS : STMIK WIDYA PRATAMA PEKALONGAN)1484BaruStatus usulan:0616027201STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:AROCHMANOtomatisasi Desain Test Case Pengujian Perangkat Lunak Metode Black-Box Testing Dengan Teknik Equivalence Partitioning Menggunakan Algoritma Genetika1485BaruStatus usulan:0607108403STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:HARI AGUNG BUDIJANTO M.Kom.PERENCANAAN STRATEGIS SISTEM INFORMASI PADA PERGURUAN TINGGI DENGAN ANALISIS CRITICAL SUCCES FACTORS (Studi Kasus : STMIK Widya Pratama Pekalongan)1486BaruStatus usulan:0619027001STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:MOSSES AIDJILIEvaluasi Tingkat Kemanfaatan Take Fusion terhadap Pedagang Batik di Kota Pekalongan1487BaruStatus usulan:0608086902STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:186

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASLAMET JOKO PRASETIONO M.KomHUBUNGAN ANTARA DAMPAK TEKNOPOLI DENGAN KECENDERUNGAN PLAGIARISME DI KALANGAN MAHASISWA (Studi Kasus : Mahasiswa Tingkat Akhir Perguruan Tinggi di Kota Pekalongan)1488BaruStatus usulan:0631057401STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:- VICTORIANUS ARIES SISWANTO M.SiKey Factor Kepuasan Konsumen pada Swalayan Indomaret Pekalongan1489BaruStatus usulan:0625037201STMIK WIDYA PRATAMA063043Penelitian Dosen PemulaKode:MAYA SAFITRIPengaruh Minuman Kunyit Asam Terhadap Penurunan Skala Nyeri Haid Primer Pada Mahasiswi Kebidanan D3 Stikes Harapan Bangsa Purwokerto1490BaruStatus usulan:0607057801SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:FETI KUMALA DEWI SSTEfektifitas SDIDTK Terhadap Peningkatan Angka Penemuan Dini Gangguan Tumbuh Kembang Pada Anak Usia Balita Di Posyandu Teluk Wilayah Puskesmas Purwokerto Selatan1491BaruStatus usulan:0609026201SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:YURIS TRI NAILI SH. KNStudi Prevalensi Kelengkapan Pengisian Persetujuan Tindakan Medik Di Rumah Sakit Ajibarang Kabupaten Banyumas1492BaruStatus usulan:0618077401SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:Ns, RAHMAYA NOVA HANDAYANI MscPENGARUH TERAPI VISUAL TEKNIK PICTURE EXCHANGE COMMUNICATION (PEC) TERHADAP KEMAMPUAN BAHASA RESEPTIF DAN EKSPRESIF PADA ANAK AUTISME DI SD PURBA ADISUPA PURBALINGGA1493BaruStatus usulan:0608117901SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:RENI DWI SETYANINGSIH SKM., MPH.Studi Prevalensi dan Kajian Faktor Risiko Hipertensi pada Lansia1494BaruStatus usulan:0611027801SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:SUCI KHASANAHPengaruh posisi condong ke depan dan pursed lips breathing terhadap peningkatan kondisi pernapasan pasien penyakit paru obstruktif kronik 1495BaruStatus usulan:0612027602SEKOLAH TINGGI ILMU KESEHATAN HARAPAN BANGSA063046Penelitian Dosen PemulaKode:187


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASETYO BUDI HARTONOPENCIPTAAN BRAND BERBASIS WEB DARI ADANYA PENDIFERENSIASIAN DAN PROMOSI PADA PT ASTRA HONDA 1504BaruStatus usulan:0606118502Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:SETIYO ADI NUGROHO SE, S.Kom., M.KomPENGEMBANGAN LOW COST SCANNER 3 DIMENSI SEBAGAI ALAT BANTU PEMBELAJARAN ANIMASI KARAKTER1505BaruStatus usulan:0607057802Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:SINDHU RAKASIWIPENGEMBANGAN SISTEM INFORMASI PENENTUAN PRESTASI KARYAWAN TELKOM DIVRE IV BERBASIS DSS DENGAN MENGGUNAKAN METODE AHP1506BaruStatus usulan:0620088801Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:Ir. PAULUS HARTANTO M.KomPenerapan Teknologi Radio Frequency Identification (RFID) Untuk Visualisasi Data Produksi Sebagai Pendukung Pengambilan Keputusan Studi Kasus di CV. Tjahja Sari Elektronics-Semarang)1507BaruStatus usulan:0624115501Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:SRI WAHYUNING S.Kom.,M.Si.ANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI INVESTASI DALAM NEGERI DI PROPINSI JAWA TENGAH1508BaruStatus usulan:0627107001Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:TAUFIK KURNIALENSYA S.Kom, M.KomSISTEM INFORMASI GEOGRAFIS POPULASI FLORA DAN FAUNA INDONESIA BERBASIS GOOGLE MAPS API (APPLICATION PROGRAMMING INTERFACE) 1509BaruStatus usulan:0627088201Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:RUSITORANCANG BANGUN SISTEM INFORMASI DENGAN ALGORITMA APRIORI UNTUK PENEMPATAN BARANG DI TOKO RITEL1510BaruStatus usulan:0627097801Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:ARSITO ARI KUNCORO S.Kom,M.KomPRESENSI SIDIK JARI TERINTEGRASI VPN PADA PERUSAHAAN MULTI LOKASI SEBAGAI PENUNJANG SISTEM PENDUKUNG KEPUTUSAN PENILAIAN KEDISIPLINAN KARYAWAN1511BaruStatus usulan:0627117902Sekolah Tinggi Elektronika Dan Komputer Pat063049Penelitian Dosen PemulaKode:189

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI HARTINIAnalisis Pengaruh Berat Badan Lebih Terhadap Penurunan Fungsi Memori Jangka Pendek Pada Anak Umur 8-12 Tahun di SD Cahaya Nur Kabupaten Kudus1512BaruStatus usulan:0601037803SEKOLAH TINGGI ILMU KESEHATAN CENDEKIA UTAMA063057Penelitian Dosen PemulaKode:EKO PRASETYOPengembangan Model Kebijakan Behaviour Safety Culture Dalam Rangka Peningkatan Keamanan dan Kesehatan Lingkungan Kerja1513BaruStatus usulan:0608048201SEKOLAH TINGGI ILMU KESEHATAN CENDEKIA UTAMA063057Penelitian Dosen PemulaKode:ARIEF HIDAYAT M.Kom.RANCANG BANGUN APLIKASI VIRTUAL LABORATORY BERBASIS OPEN SOURCE UNTUK SEKOLAH MENENGAH ATAS 1514BaruStatus usulan:0612017701STIMIK PRO VISI063058Penelitian Dosen PemulaKode:RINA ARUM PRASTYANTI SH. MHPERBANDINGAN EFEKTIVITAS UNDANG-UNDANG ITE INDONESIA DENGAN SINGAPURA DALAM PELAKSANAAN E-COMMERCE (Studi Kasus pada pengguna bisnis online di Kota Surakarta)1515BaruStatus usulan:0606127805STMIK DUTA BANGSA063059Penelitian Dosen PemulaKode:Drs. SINGGIH PURNOMO MM.Analisis Hasil Aplikasi Sistem Informasi Akuntansi Sebagai Alat Prediksi Financial Distres Pada Perusahaan Industri Barang Konsumsi Di Daftar Efek Syariah 1516BaruStatus usulan:0606066203STMIK DUTA BANGSA063059Penelitian Dosen PemulaKode:WIJI LESTARIDETEKSI POLA SEPULUH SIDIK JARI SESEORANG DENGAN MENGGUNAKAN MATHEMATICAL MORPHOLOGY DAN ALGORITMA BACK PROPAGATION JARINGAN SYARAF TIRUAN1517BaruStatus usulan:0609127402STMIK DUTA BANGSA063059Penelitian Dosen PemulaKode:INDAH WAHYU UTAMIPENGARUH MEREK, RASA, HARGA, DESAIN KEMASAN, DAN KEMUDAHAN MEMPEROLEH TERHADAP PEMBELIAN MI INSTAN DI SURAKARTA (STUDI KASUS PADA MAHASISWA SEKOLAH TINGGI MANAJEMEN INFORMATIKA KOMPUTER (STMIK)DUTA BANGSA SURAKARTA1518BaruStatus usulan:0603048201STMIK DUTA BANGSA063059Penelitian Dosen PemulaKode:AH. ZANIN NUMANEFEKTIFITAS PENERAPAN E-LEARNING MODEL EDMODO DALAM PEMBELAJARAN PENDIDIKAN AGAMA ISLAM TERHADAP HASIL BELAJAR SISWA(STUDI KASUS DI SMK MUHAMMADIYAH 1 SUKOHARJO) 1519BaruStatus usulan:0604068202STMIK DUTA BANGSA063059Penelitian Dosen PemulaKode:190




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWAHYU PURWANINGSIH MScEFEKTIFITAS PEMBERIAN MINYAK KELAPA DAN MINYAK ZAITUN TERHADAP PENCEGAHAN DEKUBITUS PADA PASIEN DI RUANG ICU RSUD Dr.MOEWARDI1544BaruStatus usulan:0605117803SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:MARYATUN MKesPERAWATAN METODE KANGURU PADA BAYI BERAT LAHIR RENDAH DI RUMAH SAKIT UMUM KABUPATEN SUKOHARJO TAHUN 20131545BaruStatus usulan:0610047601SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:LELY FIRRAHMAWATIUPAYA PREVENTIF KEJADIAN PENYAKIT INFEKSI PADA BALITA DENGAN PEMBERIAN LIL ( LIMA IMUNISASI DASAR LENGKAP) 1546BaruStatus usulan:0616128203SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:INDARWATI MkesStudi Pelaksanaan Persetujuan Rujukan Pasien JAMPERSAL di Surakarta1547BaruStatus usulan:0621076904SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:RIYANI WULANDARI skepBrain Exercise Training Terhadap Tingkat Demensia Pada Lanjut Usia1548BaruStatus usulan:0624087901SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:SRI HANDAYANI M.KebUpaya Percepatan Produksi Colostrum Melalui Massage Oxitocyn Pada Ibu Post Partum Di RSU PKU Muhammadiyah Sampangan Surakarta1549BaruStatus usulan:0627017401SEKOLAH TINGGI ILMU KESEHATAN AISYIYAH063066Penelitian Dosen PemulaKode:SISWATIEfektivitas Kelahiran Lotus dengan Kejadian Anemia Defesiensi Zat Besi Bayi Baru lahir pada Persalinan Normal di Bidan Praktik Mandiri Kabupaten Tegal Tahun 20131550BaruStatus usulan:0021078101STIKES BHAKTI MANDALA HUSADA SLAWI063071Penelitian Dosen PemulaKode:WORO HAPSARIEfektifitas Latihan Activity Daily Living dalam Meningkatkan Kemandirian dan Menurunkan Kecemasan Pada Pasien Fraktur Tulang Belakang di RS Orthopedi Purwokerto1551BaruStatus usulan:0613028001STIKES BHAKTI MANDALA HUSADA SLAWI063071Penelitian Dosen PemulaKode:194


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANOOR CHOLIFAH S.Si.TFAKTOR-FAKTOR YANG MEMPENGARUHI IBU DALAM PEMBERIAN ASI ESKLUSIF PADA BAYI USIA 0-6 BULAN DI WILAYAH PUSKESMAS KALIWUNGU KUDUS1560BaruStatus usulan:0604017901STIKES Muhammadiyah Kudus063085Penelitian Dosen PemulaKode:NOOR AZIZAH S.Si.TPENGARUH KOMPRES HANGAT DAN TERAPI MUSIK TERHADAP PERUBAHAN SKALA NYERI HAID (DYSMENORRHEA) DI STIKES MUHAMMADIYAH KUDUS1561BaruStatus usulan:0629018401STIKES Muhammadiyah Kudus063085Penelitian Dosen PemulaKode:ISLAMI S.Si.TAplikasi Telemid-Care Untuk Deteksi Dini Komplikasi Masa Nifas1562BaruStatus usulan:0630088102STIKES Muhammadiyah Kudus063085Penelitian Dosen PemulaKode:ATIEK MURHARYATIFAKTOR-FAKTOR YANG MEMPENGARUHI STRESS KERJA PERAWAT DI RUANG RAWAT INAP RSUD SUKOHARJO1563BaruStatus usulan:0618048102STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:ENI RUMIYATIBIOSUPLEMEN SINBIOTIK (PROBIOTIK DAN PREBIOTIK) DALAM SOYGHURT SEBAGAI IMUNOSTIMULAN DAN PENURUN KOLESTEROL1564BaruStatus usulan:0606068201STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:WAHYU RIMA AGUSTINPENGARUH MICROFIBER TRIANGLE PILLOW TERHADAP KEJADIAN ULKUS DEKUBITUS PADA PASIEN IMOBILISASI DI RUANG PERAWATAN RSUD SUKOHARJO1565BaruStatus usulan:0617087902STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:S.Si.T HUTARI PUJI ASTUTI M.KeSPengaruh Konseling Gizi dan Pemberian Tablet Zat besi terhadap Peningkatan Kadar Hemoglobin pada Ibu Hamil Trimester II1566BaruStatus usulan:0617088001STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:ANITA ISTININGTYASSTUDI FENOMENOLOGIS MANAJEMEN LAKTASI PADA IBU PRIMIPARA YANG MEMBERIKAN ASI EKSKLUSIF DI RT 4 RW IV PUCANGAN KARTASURA SUKOHARJO1567BaruStatus usulan:0612068703STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:196

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAESTRI KUSUMAWATIHubungan Sikap dan Perilaku Kader Menurut Ibu yang Mempunyai Balita terhadap Frekuensi Penimbangan Balita di Posyandu Kecamatan Teras Boyolali1568BaruStatus usulan:0604088701STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:MEI LINA FITRI KUMALASARIHUBUNGAN ANTARA PENGETAHUAN IBU HAMIL TENTANG HIV/AIDS DENGAN MOTIVASI MENGIKUTI PMTCT (PREVENTION-MOTHER-TO-CHILD-TRANSMISSION) DI RSUD Dr. MOEWARDI SURAKARTA1569BaruStatus usulan:0618058801STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:ARISTA APRIANIPengaruh Pendidikan Kesehatan dengan Booklet terhadap Pengetahuan dan Sikap tentang Deteksi Dini Kanker Payudara pada WUS di Surakarta Jawa Tengah1570BaruStatus usulan:0630048803STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:JOKO KISMANTOPengaruh Pendidikan Kesehatan dan Logoterapi untuk Menurunkan Kecemasan Pada Lansia di Posyandu Dahlia Puskesmas Mojosongo Surakarta 1571BaruStatus usulan:0626027003STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:WAHYUNINGSIH SAFITRIPENGARUH TERAPI RELAKSASI PROGRESIF TERHADAP PENURUNAN TINGKAT INSOMNIA PADA LANSIA DI PANTI WREDA DHARMA BAKTI KASIH SURAKARTA1572BaruStatus usulan:0627088001STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:RAHAJENG PUTRININGRUM S.S.TPengaruh Pengetahuan dan Hipnobreastfeeding pada Ibu Hamil Trimester III Terhadap Proses menyusui1573BaruStatus usulan:0628058302STIKES Kusuma Husada Surakarta063086Penelitian Dosen PemulaKode:YUNI SAPTO EDHY RAHAYUEfektifitas formulasi ekstrak sereh wangi dan minyak kelapa murni sebagai pembasmi kutu rambut1574BaruStatus usulan:0620067501STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:ANITA RATNA FAOZIYAHANALISIS KANDUNGAN OMEGA-3 MINYAK IKAN SIDAT PADA BEBERAPA JENIS IKAN SIDAT DI PERAIRAN PAYAU KABUPATEN CILACAP1575BaruStatus usulan:0618088402STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:197


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUJIANTIANALISIS FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN NEONATUS RISIKO TINGGI DI RSUD CILACAP TAHUN 20131584BaruStatus usulan:0620097902STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:MAJESTIKA SEPTIKASARIPENGARUH DUKUNGAN BIDAN TERHADAP KEBERHASILAN ASI EKSKLUSIF DI WILAYAH KERJA PUSKESMAS CILACAP SELATAN I KABUPATEN CILACAP1585BaruStatus usulan:0625098601STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:YUHANSYAH NUR FAUZIKAJIAN DOSIS DALAM FORMULASI KOMBINASI HIDROGEL BERBAHAN DASAR CINCAU HITAM DENGAN DAUN KELOR DAN EKSTRAK IKAN GABUS SEBAGAI NUTRISI MULTIFUNGSI UNTUK ORANG DENGAN HIV/AIDS (ODHA)1586BaruStatus usulan:0623108401STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:YOGI ADHI LESTARIANALISIS FAKTOR YANG BERHUBUNGAN DENGAN KEIKUTSERTAAN WANITA USIA SUBUR (WUS) DALAM DETEKSI DINI KANKER LEHER RAHIM DI KABUPATEN CILACAP1587BaruStatus usulan:0620107501STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:DWI MARYANTIFAKTOR-FAKTOR IBU YANG MEMPENGARUHI KEJADIAN KELAINAN KONGENITAL DI RSUD CILACAP TAHUN 2011 - 20131588BaruStatus usulan:0626038002STIKES Al Irsyad Al Islamiyyah Cilacap063087Penelitian Dosen PemulaKode:KURNIAWANPengaruh Karakteristik UMKM dan Karakteristik Wirausaha terhadap Akses Keuangan Pinjaman Usaha Mikro Kecil dan Menengah (UMKM) di Kabupaten Brebes1589BaruStatus usulan:0605118101STIE Islam Bumiayu063088Penelitian Dosen PemulaKode:CICI WIDOWATISkema Penjaminan dan Karakteristik Penjamin dalam Pembiayaan Usaha Mikro, Kecil, dan Menengah (UMKM): Studi Kasus di Kabupaten Brebes, Jawa Tengah1590BaruStatus usulan:0616118201STIE Islam Bumiayu063088Penelitian Dosen PemulaKode:SUGENG RIANTOPengaruh Kemitraan dan Kewirausahaan terhadap Saluran Distribusi, serta pengaruhnya terhadap Kinerja Usaha1591BaruStatus usulan:0611056503STIE Islam Bumiayu063088Penelitian Dosen PemulaKode:199

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANIES INDAH HARIYANTIPengaruh Earnings Management dan Mekanisme Corporate Governance terhadap Pengungkapan Corporate Social Responsibility serta Impilkasinya terhadap Return Saham (Studi pada Perusahaan Manufaktur yang Terdaftar di Bursa Efek Indonesia)1592BaruStatus usulan:0625038602STIE Islam Bumiayu063088Penelitian Dosen PemulaKode:YULI WIDYASTUTIEFEKTIFITAS TOUCH THERAPI PADA KAKI DENGAN MINYAKESSENSIAL OIL LAVENDER DALAM MENURUNKAN TEKANAN DARAH PENDERITA HIPERTENSI PADA USIA 50 -75 TAHUN 1593BaruStatus usulan:0610078604STIKES PKU Muhammadiyah Surakarta063089Penelitian Dosen PemulaKode:IDA UNTARI SKM., M.Kes.Pengembangan senam cegah pikun dengan Up Brain’s Game untuk meningkatkan kesehatan Lansia1594BaruStatus usulan:0629037604STIKES PKU Muhammadiyah Surakarta063089Penelitian Dosen PemulaKode:DIDI SUPRIYADI S.T., M.Kom.RANCANG BANGUN SISTEM INFORMASI KEHADIRAN DALAM MENDUKUNG GOOD UNIVERSITY GOVERNANCE (Studi kasus pada ST3 TELKOM)1595BaruStatus usulan:0618038404Sekolah Tinggi Teknologi Telematika Telkom063090Penelitian Dosen PemulaKode:SISILIA THYA SAFITRI S.T., M.T.RANCANG BANGUN BUSINESS INTELLIGENCE (BI) DENGAN GEOGRAPHIC INFORMATION SYSTEMS (GIS) UNTUK ALUMNI(Studi Kasus pada ST3 TELKOM)1596BaruStatus usulan:0631078701Sekolah Tinggi Teknologi Telematika Telkom063090Penelitian Dosen PemulaKode:TENIA WAHYUNINGRUM S.Kom., M.T.Pembangunan Web E-Commerce Dengan Metode Rapid Application Development (RAD) Untuk Produk Unggulan Desa1597BaruStatus usulan:0630068202Sekolah Tinggi Teknologi Telematika Telkom063090Penelitian Dosen PemulaKode:RIYANA DEWI S.S, M. Pd.Optimalisasi Pendekatan Berorientasi Proses dalam Mata Kuliah Menulis (Genre-Based Writing)1598BaruStatus usulan:0605118001AKADEMI BAHASA 17 AGUSTUS 1945 SEMARANG064002Penelitian Dosen PemulaKode:MARGONOPerbaikan Sistem Konversi Tenaga Genset Menggunakan Saklar Pemulih Energi Magnetik1599BaruStatus usulan:0627046102AKADEMI TEKNOLOGI SEMARANG064006Penelitian Dosen PemulaKode:200


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAKARMINTO ST., M.Eng.VARIASI HAMBATAN DOWNSTREAMKE SIDE ARM T- JUNCTION SUDUT 45O PADA SALURAN MIRING TERHADAP KARAKTERISTIKPEMISAHAN KEROSENE - AIR1608BaruStatus usulan:0630116701AKADEMI TEKNNOLOGI WARGA SURAKARTA064026Penelitian Dosen PemulaKode:MUHAMAD DANURI S.Kom, M.KomPerancangan Sistem Pengelolaan Tugas Kuliah Mahasiswa Secara Online1609BaruStatus usulan:0014077208AMIK JAKARTA TEKNOLOGI CIPTA064066Penelitian Dosen PemulaKode:NURUL EKO WIDIYASTUTI S.Si.T.,M.KesHubungan Pengetahuan dan Sikap Bidan Terhadap Pertolongan Persalinan Pada Penderita HIV/AIDS di Wilayah Kerja Kabupaten Boyolali1610BaruStatus usulan:0602047903AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:HERDINI WIDYANING PERTIWI SST. M.KesHUBUNGAN PROSEDUR PENATALAKSANAAN PRA PENJAHITAN DAN JENIS PENJAHITAN TERHADAP LAMANYA PENYEMBUHAN LUKA PERINEUM1611BaruStatus usulan:0615078401AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:TITIK WIJAYANTI S.Si.T.,M.KesEFEKTIFITAS KELAS IBU HAMIL TERHADAP DETEKSI DINI TANDA BAHAYA KEHAMILAN1612BaruStatus usulan:0605018002AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:TINAH S.S.T.Pengaruh Pelaksanaan Program Kelas Ibu Hamil Terhadap Pengetahuan dan Sikap Ibu Hamil Dalam Deteksi Dini Resiko Tinggi 1613BaruStatus usulan:0603046202AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:ARDIANI SULISTIANI S.S.T.,M.KesPengaruh Pelatihan Asuhan Persalinan Normal Terhadap kompetensi Bidan tentang Management Aktif Kala III Persalinan1614BaruStatus usulan:0624057803AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:NOVITA NURHIDAYATI SST, M.KesEFEKTIFITAS PEMBELAJARAN FIELDTRIP TERHADAP PENCAPAIAN KOMPETENSI DALAM DETEKSI DINI PERKEMBANGAN ANAK1615BaruStatus usulan:0628117901AKADEMI KEBIDANAN ESTU UTOMO064071Penelitian Dosen PemulaKode:202

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJOKO ROCHMADI S.T. M.PdGasifikasi Batubara dan Limbah Pertanian Guna Mendapatkan Bahan Bakar Gas Alternatif1616BaruStatus usulan:0618086703AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:AGUS NUGROHO S.T. M.PdPengaruh Struktur Bagian Dalam Knalpot Standart Dan Knalpot Modifikasi Diesel Stasioner Terhadap Tingkat Kebisingan Lingkungan 1617BaruStatus usulan:0615086802AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:DWIYANTOMerancang Pembelajaran Interaktif Mata Kuliah Komponen Elektronika Sebagai Media Pembelajaran Online Bagi Mahasiswa Akademi Teknologi AUB Surakarta1618BaruStatus usulan:0616027803AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:ACHMAD CHOERUDIN MMMODEL INTEGRASI SPIRITUALITAS TERHADAP SIKAP DAN PERILAKU KERJA DENGAN KECERDASAN EMOSIONAL SEBAGAI MEDIASI: PENDEKATAN STRUCTURAL EQUATION MODELING (SEM)1619BaruStatus usulan:0601057701AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:SINGGIH TRIJANTO STPENGEMBANGAN DAN PEMANFAATAN SERAT PELEPAH PISANG UNTUK MATERIAL TEKNIK: TINJAUAN BERDASARKAN SIFAT FISIK DAN MEKANIS BAHAN1620BaruStatus usulan:0615017601AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:SUDALTO ST. M.PdKonsep Metadata Untuk Aplikasi E-Learning1621BaruStatus usulan:0609076301AKADEMI TEKNOLOGI AUB064076Penelitian Dosen PemulaKode:AMIK KHOSIDAHPERSEPSI IBU RUMAH TANGGA TENTANG VOLUNTARRY CONSELING AND TESTING (VCT) TERHADAP PERILAKU PENCEGAHAN HIV AIDS MELALUI VCT DIWILAYAH KERJA PUSKESMAS BATURADEN KABUPATEN BANYUMAS1622BaruStatus usulan:0610057702Akademi Kebidanan YLPP Purwokerto064079Penelitian Dosen PemulaKode:SUMARNIfaktor-faktor yang mempengaruhi keterlambatan rujukan pada kasus kematian ibu di kabupaten Banyumas periode tahun 2011-20131623BaruStatus usulan:0620088002Akademi Kebidanan YLPP Purwokerto064079Penelitian Dosen PemulaKode:203

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAARTATHI EKA SURYANDARIAnalisis Determinan yang Mempengaruhi Bidan Desa dalam Ketepatan Rujukan pada Kasus Pre eklampsia/eklampsia di kabupaten Banyumas.1624BaruStatus usulan:0629018002Akademi Kebidanan YLPP Purwokerto064079Penelitian Dosen PemulaKode:JUNAIDI EDY PURWANTOPemanfaatan Multimedia Interaktif Pada Pembelajaran Jantung dan Peredaran Darah Menggunakan Model Teams Games Tournament Untuk Meningkatkan Hasil Belajar dan Aktivitas Mahasiswa1625BaruStatus usulan:0613067401AKADEMI PEREKAM MEDIK & INFO KES CITRA MEDIKA064088Penelitian Dosen PemulaKode:TOMINANTO S.Kom., M.Cs.Membangun Aplikasi SMS Gateway Untuk Meningkatkan Pelayanan Pendaftaran Pasien Rawat Jalan (Studi Kasus Pada BBKPM Surakarta)1626BaruStatus usulan:0604057901AKADEMI PEREKAM MEDIK & INFO KES CITRA MEDIKA064088Penelitian Dosen PemulaKode:SRI WIDODO S.Kom., MMPENGEMBANGAN PERANGKAT LUNAK PENDETEKSI OTOMATIS PENYAKIT MALARIA TROPIKA PADA CITRA PREPARAT DARAH SEBAGAI ALAT BANTU DIAGNOSIS1627BaruStatus usulan:0628107201AKADEMI PEREKAM MEDIK & INFO KES CITRA MEDIKA064088Penelitian Dosen PemulaKode:DEWI ELLIANA SKMPENERAPAN MODEL SMS REMINDER SEBAGAI MEDIA PENYULUHAN KESEHATAN IBU HAMIL DALAM UPAYA PENCEGAHAN PENYULIT DAN KOMPLIKASI KEHAMILAN DI KOTA SEMARANG1628BaruStatus usulan:0611027703AKADEMI KEBIDANAN ABDI HUSADA064091Penelitian Dosen PemulaKode:TITIK SULISTYAWATI MH.KesANALISIS HUBUNGAN TINGKAT PENGETAHUAN TENTANG PACARAN YANG SEHAT REMAJA DENGAN PERILAKU SEKS BEBAS 1629BaruStatus usulan:0621014701AKADEMI KEBIDANAN ABDI HUSADA064091Penelitian Dosen PemulaKode:ROHMADI S.KomIdentifikasi Karakteristik Informasi Pada Sistem Informasi Manajemendan Pengeloaan Administrasi Terintegrasi (SIMPATI) Dan Pengaruhnya Terhadap Kinerja Manajerial1630BaruStatus usulan:0613127801AKADEMI PEREKAM MEDIK DAN INFOKES MITRA HUSADA064094Penelitian Dosen PemulaKode:TRI LESTARIKajian Kemampuan Masyarakat Dalam Mengidentifikasi Masalah Kesehatan Lokal Pada Program Pencegahan dan Penanggulangan Human Immunodeficiency Virus (HIV)/ Acquired Immunodeficiency Syndrome(AIDS)1631BaruStatus usulan:0607088101AKADEMI PEREKAM MEDIK DAN INFOKES MITRA HUSADA064094Penelitian Dosen PemulaKode:204

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANTIK PUJIHASTUTI SKMHubungan kelengkapan pengisian informasi dengan keakuratan kode diagnosis penyakit dan tindakan pada dokumen rekam medis pasien rawat inap1632BaruStatus usulan:0618047801AKADEMI PEREKAM MEDIK DAN INFOKES MITRA HUSADA064094Penelitian Dosen PemulaKode:SRI SUGIARSI SKM, M.KesPotret Praktik Pemberian Air Susu Ibu Eksklusif Pada Ibu Pasca Melahirkan di Wilayah Puskesmas Jaten Kabupaten Karanganyar1633BaruStatus usulan:0614087401AKADEMI PEREKAM MEDIK DAN INFOKES MITRA HUSADA064094Penelitian Dosen PemulaKode:ANA WIGUNANTININGSIH S.S.TPengaruh Penggunaan Gurita terhadap Frekuensi Kejadian Gumoh pada Bayi di Kabupaten Karanganyar 1634BaruStatus usulan:0622108201AKADEMI KEBIDANAN MITRA HUSADA064095Penelitian Dosen PemulaKode:S.Farm CRESCENTIANA EMY DHURHANIA M.ScPengaruh Cara Pemanfaatan Sarang Semut (Myrmecodia pendens) dalam Pengobatan Kanker terhadap Aktivitas Antioksidan, Kadar Tokoferol dan Flavonoid Total1635BaruStatus usulan:0606058001AKADEMI FARMASI NASIONAL064099Penelitian Dosen PemulaKode:AGIL NOVIANTOUJI AKTIVITAS HIPOLIPIDEMIK DAN ANTIATEROSKLEROSIS KENIKIR (Cosmos caudatus) PADA TIKUS JANTAN YANG DIINDUKSI PROPILTIOURASIL1636BaruStatus usulan:0612118602AKADEMI FARMASI NASIONAL064099Penelitian Dosen PemulaKode:NOVENA YETY LINDAWATIFORMULASI GRANUL EFFERVESCENT DARI EKSTRAK BROKOLI (Brassica oleracea L.) DENGAN VARIASI KADAR PEMANIS ASPARTAM1637BaruStatus usulan:0622108001AKADEMI FARMASI NASIONAL064099Penelitian Dosen PemulaKode:M.Si., Apt HARTONOPOTENSI ANTI HIPERKOLESTEROLEMIA EKSTRAK TUMBUHAN SARANG SEMUT (Myrmecodia Pendans Merr. & Perry)1638BaruStatus usulan:0629117201AKADEMI FARMASI NASIONAL064099Penelitian Dosen PemulaKode:KUDARTIPerbedaan pengetahuan remaja tentang seks bebas pada SMA perkotaan dan pedesaan di Kabupaten Kudus1639BaruStatus usulan:0613118101AKADEMI KEBIDANAN MARDIRAHAYU064101Penelitian Dosen PemulaKode:205

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARIFA CATURININGSIHHUBUNGAN PENGETAHUAN SIKAP DAN MOTIVASI KADER DENGAN KEHADIRAN DALAM PELAYANAN POSYANDU DIDESA TUMPANG KRASAK1640BaruStatus usulan:0608098201AKADEMI KEBIDANAN MARDIRAHAYU064101Penelitian Dosen PemulaKode:DINI ENGGAR WIJAYANTIEfektivitas Hypnobrithing Prenatal Class Terhadap Lamanya Proses Persalinan1641BaruStatus usulan:0630048101AKADEMI KEBIDANAN MARDIRAHAYU064101Penelitian Dosen PemulaKode:IKE RINA WULANDARIPerbedaan Pengetahuan Remaja tentang Kehamilan Tidak Diinginkan Sebelum dan Sesudah Penyuluhan1642BaruStatus usulan:0627098701AKADEMI KEBIDANAN MARDIRAHAYU064101Penelitian Dosen PemulaKode:NITA YUNIANTI RATNASARIEFEKTIVITAS PENERAPAN KOMUNIKASI TERAPEUTIK KELUARGA TERHADAP STATUS HARGA DIRI LANSIA1643BaruStatus usulan:0607068001AKADEMI KEPERAWATAN GIRI SATRIA HUSADA064127Penelitian Dosen PemulaKode:MARNIKhasiat Ramuan Jamu Cekok terhadap Peningkatan Berat Badan Pada Anak Usia 1 - 5 tahun1644BaruStatus usulan:0607027702AKADEMI KEPERAWATAN GIRI SATRIA HUSADA064127Penelitian Dosen PemulaKode:SRI HANDAYANIEFEKTIFITAS PELATIHAN PERAWATAN PAYUDARA POST PARTUM METODE MASSAGE ROLLING (PUNGGUNG) TERHADAP PENGETAHUAN DAN KETRAMPILAN KADER KESEHATAN DI WILAYAH KERJA PUSKESMAS BATURETNO1645BaruStatus usulan:0610017701AKADEMI KEPERAWATAN GIRI SATRIA HUSADA064127Penelitian Dosen PemulaKode:MARGARETA RETNO PRIAMSARIAktivitas Analgetika Antiinflamasi dan Ekspresi Enzim Cyclooxygenase (COX-1 dan COX-2) Ekstrak Etanolik Daun Kenikir (Cosmos caudatus K.) Pada Mencit Jantan Galur Balb/C1646BaruStatus usulan:0617107902Akademi Farmasi Theresiana Semarang064129Penelitian Dosen PemulaKode:FEF RUKMININGSIHPembuatan Gel Ekstrak Waluh (Curcurbita Moschata, Ex Poir)Sebagai Alternatif Pengobatan Ulkus Traumatikus Pada Rongga Mulut1647BaruStatus usulan:0616107201Akademi Farmasi Theresiana Semarang064129Penelitian Dosen PemulaKode:206

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARETNO KUMALASARIPengaruh Pemberian Jamu Uyup-Uyup Terhadap Kelancaran Pengeluaran Air Susu Ibu (ASI) Pada Ibu Nifas di Kabupaten Purbalingga1648BaruStatus usulan:0629018701AKADEMI KEBIDANAN PERW IRA HUSADA PURBALINGGA064130Penelitian Dosen PemulaKode:MARTINDA BAKTIPENGETAHUAN, SIKAP DAN PERILAKU SEKS BEBAS PADA REMAJA DI SMP NEGERI 1 SUKOHARJO1649BaruStatus usulan:0605068901AKADEMI KEBIDANAN CITRA MEDIKA SURAKARTA064133Penelitian Dosen PemulaKode:SITI FARIDA SSiTSENAM HAMIL SEBAGAI UPAYA UNTUK MEMPERLANCAR PROSES PERSALINAN DI RUMAH SAKIT KASIH IBU SURAKARTA1650BaruStatus usulan:0616098601AKADEMI KEBIDANAN CITRA MEDIKA SURAKARTA064133Penelitian Dosen PemulaKode:DARAH IFALAHMAANALISA PELAKSANAAN INISIASI MENYUSU DINI (IMD) SEBAGAI UPAYA PENCEGAHAN PRIMARY POSTPARTUM HAEMORRHAGE DI RB SUKO ASIH SUKOHARJO1651BaruStatus usulan:0618108701AKADEMI KEBIDANAN CITRA MEDIKA SURAKARTA064133Penelitian Dosen PemulaKode:YUSIANTI SILVIANIUJI EFEKTIVITAS EKSTRAK AQUADEST, ETIL ASETAT DAN ETANOL BUAH LERAK (Sapindus rarak) TERHADAP Escherichia coli PATOGEN1652BaruStatus usulan:0610078701AKADEMI ANALIS KESEHATAN NASIONAL064145Penelitian Dosen PemulaKode:WIMPYUJI AKTIVITAS ANTIOKSIDAN KOMBINASI EKSTRAK SARANG SEMUT ( Myrmecodia Pendans) DAN DAUN SIRSAK (Annona muricata) DENGAN METODE DPPH (2,2-diphenyl-1-picrilhidrazyl)1653BaruStatus usulan:0618018601AKADEMI ANALIS KESEHATAN NASIONAL064145Penelitian Dosen PemulaKode:DIDIK WAHYUDIUji Efektifitas Ekstrak Seledri (Apium graveolens L) Sebagai Penghambat Produksi Biofilm Pada Salmonella typhi1654BaruStatus usulan:0626127502AKADEMI ANALIS KESEHATAN NASIONAL064145Penelitian Dosen PemulaKode:CISILLIA ADHIYANIPengaruh Kualitas Tidur Dengan Jumlah Sel Darah Pekerja Dengan Sistem Shift1655BaruStatus usulan:0623038004AKADEMI ANALIS KESEHATAN NASIONAL064145Penelitian Dosen PemulaKode:207

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABETTY SUNARYANTI S.Kep.NsEFEKTIFITAS MINYAK KELAPA DENGAN PENDIDIKAN KESEHATAN TENTANG REPOSISI TERHADAP PENCEGAHAN DEKUBITUS1656BaruStatus usulan:0616067701Akademi Keperawatan 17 Karanganyar064149Penelitian Dosen PemulaKode:IPANG SUPARTI S.Si.TPengaruh Statik Kontraksi Terhadap Kecepatan Kembalinya Peristaltik Usus Pada Pasien Post Sectio Caesarea (SC)1657BaruStatus usulan:0622118201Akademi Kebidanan Graha Mandiri Cilacap064152Penelitian Dosen PemulaKode:DRS ARDI WIDYATMOKO M.Eng.Analisa Perambatan Retak Fatik Velg Paduan Aluminum A 356 Hasil Pengecoran Sentrifugal 1658BaruStatus usulan:0604016201POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:SRI HUTAMI S.E., M.Si., AktCORPORATE GOVERNANCE DAN AUDIT QUALITY SEBAGAI PENDETEKSI EARNINGS MANAGEMENT PERUSAHAAN PADA SAAT IPO1659BaruStatus usulan:0017027801POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:- HURIYAH SE, M.SiPengaruh Penerapan Sistem Pengendalian Intern Terhadap Non Performing Loan BPR di Wilayah Karesidenan Surakarta1660BaruStatus usulan:0607116701POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:DRS WARSITOPeningkatan Sifat Mekanis Baja Karbon Rendah Melalui Metode Nitrocarburizing DC-Plasma.1661BaruStatus usulan:0602076201POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:HARJONO STHUBUNGAN JUMLAH INPUT LAYER DAN OUTPUT LAYER NEURAL NETWORK TERHADAP TINGKAT AKURASI SISTEM HANDWRITING RECOGNITION DENGAN METODE BACKPROPAGATION1662BaruStatus usulan:0631127204POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:TAMAN GINTING S.KOMMACHINE LEARNING UNTUK LOCALIZATION BERBASIS RSS MENGGUNAKAN CELL- ID GLOBAL SYSTEM FOR MOBILE COMMUNICATION (GSM)1663BaruStatus usulan:0629037903POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:208

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYAYA FINAYANI S.T.,M.EngSimulasi Model Matematik Rol Penggulung Pada Industri MetallizingBerbasis Metode Diskritisasi Tustin 1664BaruStatus usulan:0620117102POLITEKNIK PRATAMA MULIA065002Penelitian Dosen PemulaKode:AGUS DWI ATMOKO SE, MMSISTEM INFORMASI HARGA POKOK PROSES BAGI USAHA KECIL DAN MENENGAH DALAM MENINGKATKAN KUALITAS PROSES PRODUKSI(Studi Kasus Pada Perusahaan Genteng Sokka Kebumen)1665BaruStatus usulan:0609098001POLITEKNIK SAWUNGGALIH AJI065008Penelitian Dosen PemulaKode:EDY SUSANTOHIK NAIK KELAS((Kajian Sosial Ekonomi Warung HIK (Hidangan Istimewa Kampung) di Kota Surakarta)) Sebagai Usaha Kecil Menengah Berbasis Kerakyatan1666BaruStatus usulan:0617098301POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:IQBAL FIRDAUSRANCANG BANGUN E- RESTO MENGGUNAKAN WEB SERVICES UNTUK RESTORAN KELUARGA DI KOTAMADYA SURAKARTA1667BaruStatus usulan:0614108301POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:SIGIT SUROTOPENGARUH KOMPOSISI DAN UKURAN SERBUK BRIKET YANG TERBUAT DARI BATUBARA DAN JERAMI PADI TERHADAP KARAKTERISTIK PEMBAKARAN1668BaruStatus usulan:0603127901POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:Drs. SUDARMAJIEFEKTIVITAS PEMANFAATAN FASILITAS PEJALAN KAKI (TROTOIR, JEMBATAN PENYEBARANGAN DAN ZEBRA CROSS) DI KOTA SURAKARTA1669BaruStatus usulan:0608106502POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:DEWI AMELIA LESTARIAnalisis Pendidikan Gratis Di SMA - SMK Di Surakarta Menuju Pendidikan Indonesia Yang Berkeadilan1670BaruStatus usulan:0608088301POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:ADE WAHYU WULANDARIAKSI SENIMAN LIAR (VANDALISME)Kajian Aspek Sosial dan Hukum Terhadapa Aksi Vandalisme Pada Fasilitas Publik di Kota Surakarta1671BaruStatus usulan:0630097402POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:209

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEDY SUSENADAMPAK PENGGUNAAN INTERNET TERHADAP KECERDASAN PELAJAR SEKOLAH MENENGAH ATAS (SMA) DI DAERAH PEDESAAN DALAM RANGKA PENINGKATAN KUALITAS PENDIDIKAN DI DAERAH PEDESAAN1672BaruStatus usulan:0623097702POLITEKNIK INDONUSA065013Penelitian Dosen PemulaKode:SARNO S.P, M.ScAnalisis Potensi dan Distribusi Serta Strategi Pengembangan Komoditas Melati Gambir di Kecamatan Rakit Kabupaten Banjarnegara1673BaruStatus usulan:0601128101Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:OKTI HANAYANTI S.P, M.SiPengembangan Cabai Dieng Sebagai Varietas Unggul Lokal Banjarnegara1674BaruStatus usulan:0601108401Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:DWI ARI CAHYANI S.T.P, M.ScPengolahan Tepung Salak Sebagai Produk Diversifikasi Pangan Berbasis Potensi Lokal Kabupaten Banjarnegara1675BaruStatus usulan:0606018203Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:SHINTA SISWOYO PUTRI S.S.T, M.KesANALISIS FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PEMILIHAN ALAT KOTRASEPSI INTRA UTERINE DEVICE (IUD) DI WILAYAH KERJA PUSKESMAS PAGENTAN 2 TAHUN 20131676BaruStatus usulan:0617038601Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:LIA ARIA RATMAWATI S.S.T, M.KesANALISIS FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEPATUHAN BIDAN DALAM PENGGUNAAN PARTOGRAF DI WILAYAH KERJA DINAS KESEHATAN KABUPATEN BANJARNEGARA TAHUN 20141677BaruStatus usulan:0613028501Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:DEWIE SULISTYORINI S.S.T, M.kesAnalisis Faktor-faktor yang Mempengaruhi Kejadian BBLR di Kabupaten Banjarnegara 1678BaruStatus usulan:0617118502Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:ARUM ASRIYANTI SUHASTYO S.P, M.SiPengaruh pemberian berbagai dosis mikroorganisme local (mol) bonggol pisang dan pupuk kandang kotoran sapi terhadap pertumbuhan dan hasil kedelai (Glycine max(L.)merill)1679BaruStatus usulan:0610038002Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:210

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAENY SOFIYATUN S.Si, M.Si, M.ScDeteksi Resistensi Nyamuk Aedes aegypti sebagai Vektor Demam Berdarah Dengue terhadap Insektisida Organofosfat1680BaruStatus usulan:0630118402Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:BARNI S.Pd, M.APERSPEKTIF MASYARAKAT TERHADAP DUKUN BAYI DAN BIDAN DALAM PERSALINAN DI KECAMATAN BANJARMANGU BANJARNEGARA1681BaruStatus usulan:0623048502Politeknik Banjarnegara065021Penelitian Dosen PemulaKode:TRI SUWARNIANALISIS PELAKSANAAN PENGGUNAAN ALAT PERLINDUNGAN DIRI OLEH BIDAN SELAMA PERTOLONGAN PERSALINAN1682BaruStatus usulan:0619028601Politeknik Kesehatan BHakti Mulia065023Penelitian Dosen PemulaKode:TRISMIANTO ASMO SUTRISNOPENGEMBANGAN MODEL CUSTOMER RELATIONSHIP MANAGEMENT MENGGUNAKAN TEKNOLOGI SMS GUNA MENINGKATKAN KEPATUHAN AKSEPTOR KB1683BaruStatus usulan:0610037303Politeknik Kesehatan BHakti Mulia065023Penelitian Dosen PemulaKode:SIWI HASTUTIAktivitas Analgetik Dan Antiinflamasi Ekstrak Etil Asetat Daun Seligi (Phyllanthus buxifolius Muell. Arg) Pada Mencit Galur Serta Analisis Ekspresi COX-1 dan COX-21684BaruStatus usulan:0628057502Politeknik Kesehatan BHakti Mulia065023Penelitian Dosen PemulaKode:MATEUS RUDI SUPSIADJI S.S.,M.PdMeningkatkan Kesadaran Budaya Indonesia Mahasiswa Melalui Pemanfaatan Cerita Rakyat Dalam Pembelajaran Bahasa Inggris1685BaruStatus usulan:0727126402UNIVERSITAS 17 AGUSTUS 1945 SURABAYA071001Penelitian Dosen PemulaKode:DRA.EC SRI BUDI KASIYATI MMMembangun kompetensi kewirausahaan melalui motivasi berwirausaha dan pembelajaran kewirausahaan mahasiswa FE angkatan 2012 Untag'45 Surabaya1686BaruStatus usulan:0714116401UNIVERSITAS 17 AGUSTUS 1945 SURABAYA071001Penelitian Dosen PemulaKode:HOLY LYDIA WIHARTO Dilp. Ing., M.T.Identifikasil Jenis Material dengan Time of Frequency Sensor Ultrasonik1687BaruStatus usulan:0716075501UNIVERSITAS 17 AGUSTUS 1945 SURABAYA071001Penelitian Dosen PemulaKode:211


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANITA ASNAWI S.Sos., M.MPengaruh Faktor Sosial dan Faktor Personal terhadap Sikap Konsumen dan Minat Beli Barang Fashion Palsu di Kota Surabaya, Sidoarjo, Mojokerto.1696BaruStatus usulan:0729047101UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:YENNY SKONSTRUKSI CALEG PEREMPUAN DALAM PEMILU 2014 DI MEDIA MASSA(Analisis Terhadap Pemberitaan Caleg Perempuan Dalam Pemilu 2014 di Harian Republika, Kompas, dan Jawa Pos Edisi Januari – April 2014)1697BaruStatus usulan:0722037001UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:NURHAYATI SE., Ak., MSA (HumBis)PENINGKATAN KUALITAS CORPORATE GOVERNANCE (CG) MELALUI INTERNET FINANCIAL REPORTING (IFR)1698BaruStatus usulan:0727097301UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:VERONIKA NUGRAHENI SRI LESTARI SE, MMPengaruh Kualitas Kehidupan Kerja ( Quality Of Work Life / QWL ) Terhadap Produktivitas Kerja Karyawan Pada PT. BHAKTI KARYA KURNIA SURABAYA 1699BaruStatus usulan:0725107101UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:ANIK VEGA VITIANINGSIH S.Kom,MTWEB MAP UNTUK MENGETAHUI POTENSI LAHAN PERTANIAN DAN PERIKANAN DI KABUPATEN SIDOARJO1700BaruStatus usulan:0712068101UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:ALVY MULYANING TYAS SE, M.MImplementasi Konsep New Public Management Di Pemerintah Daerah Sebagai Usaha Mewujudkan Good Governance1701BaruStatus usulan:0730087201UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:DAVID HERMASYAH S.Kom, M.TMedia Pembelajaran Interaktif Pengenalan Satwa Penyu untuk Pendidikan Anak usia Dini1702BaruStatus usulan:0720067403UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:ZULAIKHApengaruh branding sekolah terhadap tingkat perolehan siswa baru pada smp swasta di surabaya1703BaruStatus usulan:0712016701UNIVERSITAS DR SOETOMO071005Penelitian Dosen PemulaKode:213



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYORDAN MALINO BATARA GOAStudi tentang Pro-poor Budgeting Pemerintah Kota Surabaya Tahun 2011-2014 (Masa Kepemimpinan Walikota Perempuan Tri Rismaharini) 1720BaruStatus usulan:0715087702UNIVERSITAS WIJAYA KUSUMA071009Penelitian Dosen PemulaKode:RR ANI DIJAH RAHAJOE ST., M.Cs.Analisis Faktor Penyebab Resiko Tinggi Pada Ibu dan Janin Pada Saat Persalinan Menggunakan Metode PCA (Pricipal Component Analysis) di PUSKESMAS Donomulyo Desa Banjarejo Kecamatan Donomulyo Kabupaten Malang.1721BaruStatus usulan:0012057301UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:AGUS SUSETYOHADIPENGARUH COMPETENCY DAN ATTITUDE TERHADAP PERSONAL PROBLEM DAN JOB PERFORMANCE PEGAWAI NEGERI SIPIL DI LINGKUNGAN PEMERINTAH KABUPATEN SIDOARJO1722BaruStatus usulan:0730046502UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:HARI TOHA HIDAYATSistem Pendukung Keputusan Penentuan Kualitas Perairan untuk Budidaya Rumput Laut Berdasarkan Perbedaan Iklim dengan Berbasis Sistem Informasi Geografi1723BaruStatus usulan:0714108502UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:FITRIA WIDIYANI ROOSINDAKesetaraan Gender dalam Penyelesaian Konflik Korban Lumpur Lapindo Sidoarjo1724BaruStatus usulan:0706088003UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:ITA NURLITAOPINI PUBLIK TERHADAP KREDIBILITAS CALON PRESIDEN RI PADA PILPRES TAHUN 2014 DALAM PERSPEKTIF MAHASISWA1725BaruStatus usulan:0711046901UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:ANIK BUDIATI S.T., M.T.KAJIAN STANDARISASI KEBUTUHAN SATUAN RUANG PARKIR (SRP)BERDASARKAN LUAS UNIT DAN KARAKTERISTIK PENDUKUNGNYA UNTUKAPARTEMEN DI SURABAYA1726BaruStatus usulan:0729087101UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:WIWIET HERULAMBANGPEMODELAN PENGARUH PEMUPUKAN TERHADAP POLA TUMBUH TANAMAN SAWI HIJAU MENGGUNAKAN BACKPROPAGATION NEURAL NETWORK1727BaruStatus usulan:0719126702UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:216

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATIRA FITRIAWARDHANISTRATEGI KOMUNIKASI KELUARGA SEBAGAI SALAH SATU ALTERNATIF MEMINIMALISIR DAMPAK NEGATIF TINGGINYA INTENSITAS PENGGUNAAN SOCIAL-MEDIA PADA REMAJA DI SURABAYA 1728BaruStatus usulan:0722068501UNIVERSITAS BHAYANGKARA SURABAYA071010Penelitian Dosen PemulaKode:KRISNADI HARIYANTOPERANCANGAN PENGUKURAN KINERJA KARYAWAN MENGGUNAKAN METODE ANALYTICAL HIERARCHY PROCESS (AHP) DAN FUZZY TRIANGULAR AHP1729BaruStatus usulan:0711107402UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:SUJANI S.E., M.M.Pengaruh Brand Equity dan Customer Value Terhadap Customer Satisfaction Rumah Sakit Umum Daerah Bhakti Dharma Husada Surabaya1730BaruStatus usulan:0720127303UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:MOHAMMAD SODIKINPengaruh Persepsi Wajib Pajak Usaha Jasa Konstruksi Atas Pengenaan PPh Final dan Kemudahan Administrasi Pajak terhadap Kepatuhan Formal Wajib Pajak di Surabaya1731BaruStatus usulan:0721056601UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:YOSHI TRIAS PRATIWI SE.,M.SiStrategy Map Balanced Scorecard: Sistem Manajemen Untuk Implementasi Strategi Perusahaan (Studi Kasus PT Erratisa Purnama)1732BaruStatus usulan:0720108002UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:AMPAR JAYA SUWONDOPENINGKATAN PRODUKTIVITAS BATAKO(PAVING STONE)DENGAN PENDEKATAN VALUE ENGINEERINGDI JAYA ABADI BETON1733BaruStatus usulan:0726037802UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:ONNY PRAMANA YUDHIAAplikasi Sistem Informasi Penjualan Apotek1734BaruStatus usulan:0714057903UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:IMAM KHOLIKANALISIS FAKTOR YANG MEMPENGARUHI COST OVERRUNS PADA PROYEK-PROYEK YANG DIKERJAKAN PT.MECO INOXPRIMA1735BaruStatus usulan:0712056802UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:217

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHARIYONOPengaruh faktor faktor career anchor terhadap kepuasan kerja karyawan pada dinas kesehatan pemda kabupaten Pasuruan.1736BaruStatus usulan:0728026903UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:MUHAROMDesain Eksperimen Taguchi Untuk Meningkatkan Kualitas Batu Bata Berbahan Baku Tanah Liat1737BaruStatus usulan:0712106603UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:SUBADERISistem Penggajian berbasis Kompetensi1738BaruStatus usulan:0727086003UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:MOCHAMAD SYAIFUL ARIFSurvei Kepuasan Kerja Karyawan Bagian Produksi PT. PAL Indonesia (Persero)1739BaruStatus usulan:0725077601UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:SLAMET RIYADI S.T., M.T.Studi Ekperimen Multi Material Sintering Pada Material Polyethylene (PE)1740BaruStatus usulan:0719117101UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:YURILLA ENDAH MULIATIEPENGEMBANGAN MODEL PEMBELIAN BERULANG PADA PUSAT GROSIR DENGAN ANTISEDEN BRAND, QUALITY, PATRON STATUS, FASHION INVOLVEMENT DAN STORE ATMOSPHERE 1741BaruStatus usulan:0706047301UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:TRISA INDRAWATI SE.,MM.ANALISIS BELANJA BERBASIS KINERJA KEUANGAN DAERAH KOTA SURABAYA1742BaruStatus usulan:0705117101UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:CHANDRA KARTIKAAnalisis Financial Bonds,Social Bonds, Structual Bonds, dan Pengaruhnya Terhadap Loyalitas Pelanggan Pada Puskesmas Di Surabaya Barat1743BaruStatus usulan:0713048304UNIVERSITAS WIJAYA PUTRA071011Penelitian Dosen PemulaKode:218





NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARINA HENDRAWATYANALISIS PENGARUH BAURAN PEMASARAN TERHADAP KEPUTUSAN KONSUMEN DALAM PEMBELIAN RUMAH DI PERUMAHAN GREEN HILLS REGENCY TRENGGALEK ” (Studi Pada PT. Rimbun Perusahaan Developer Cabang Trenggalek)1776BaruStatus usulan:0705097501UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:SRI WIwORO RETNO INDAH HHubungan Stres Dengan Prokrastinasi Pada Mahasiswa (Guru-Guru PAUD) universitas Wisnuwardhana Malang1777BaruStatus usulan:0710026902UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:RAHMAWATIHubungan Antara Asertifitas Dengan Prokastinasi Akademik Pada Mahasiswa Psikologi Universitas Wisnuwardhana Malang. 1778BaruStatus usulan:0724066901UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:FEBRY CHRISDANTYPENANGANAN PELANGGARAN KAMPANYE PEMILIHAN UMUM DPR, DPD, DAN DPRD TAHUN 2014 DI WILAYAH KABUPATEN/KOTA (Study khusus Malang Raya : Kota Malang, Kabupaten Malang dan Kota Batu)1779BaruStatus usulan:0701068205UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:ANDIA KUSUMA DAMAYANTIKESIAPAN ANAK MASUK SEKOLAH DASAR DITINJAU DARI DUKUNGAN ORANGTUA DAN MOTIVASI BELAJAR1780BaruStatus usulan:0713017701UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:PARMO S.T., M.TPerbaikan Kekuatan dan Daktilitas Balok Beton Bertulang Menggunakan Glass Fiber Reinforced Polymer (GFRP) Strips1781BaruStatus usulan:0724028203UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:LUQMAN MAAJIDPEMILIHAN ALTERNATIF ENERGI TERBARUKAN DI KABUPATEN MALANG1782BaruStatus usulan:0701058204UNIVERSITAS WISNUWARDHANA071028Penelitian Dosen PemulaKode:ANIS QUSTONIAH S.T., M.T.Implementasi Teknologi VOIP (Voice Over Internet Protocol) Pada Jaringan PABX (Private Automatic Branch eXchange) di Lingkungan Universitas Widyagama Malang1783BaruStatus usulan:0027107602UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:223

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADRS ABDURRACHMAN ANTONI MMDETERMINAN PROFITABILITAS BANK GO-PUBLIC DI INDONESIA :BUKTI EMPIRIS PASCA KRISIS KEUANGAN GLOBAL1784BaruStatus usulan:0001075401UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:ALFIANA SE. MSIAnalisis Perbedaan Saham Sebelum dan Sesudah Stock Split Terhadap Return Saham Pada Perusahaan Go Publik Sebagai Informasi Kepada Investor1785BaruStatus usulan:0015036801UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Drs UNTUNG WAHYUDI M.Si, AkModel Pengelolaan Keuangan dan Akuntabilitas Entitas Pendidikan: Upaya Implementasi Keterbukaan Informasi Publik1786BaruStatus usulan:0716076801UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:IR UNTUNG SUGIARTI MPPENGARUH PEMBERIAN LIMBAH SISA IKAN DAN PEMULSAAN TERHADAP SIFAT ANTIBAKTERIUMBI BAWANG PUTIH ( ALLIUM SATIVUM)VARIETAS LUMBU PUTIH.1787BaruStatus usulan:0701115602UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:AKHMAD FARID ST. MT.Pengaruh Penggunaan Saringan Pengumpul Kalor Terhadap Efisiensi Penyerapan Kalor Dari Nyala Api Bahan Bakar Gas LPG1788BaruStatus usulan:0705096502UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:SILVIANA S.T., M.T.Redesain Transmisi Mesin Pemeras Tebu Type MFM 160 untuk industri rumahan dengan pendekatan Rekayasa Nilai1789BaruStatus usulan:0703047602UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Drs. MOCHAMMAD SATRIYO MM.Pengaruh Stres Kerja terhadap Burnout serta Implikasinya pada Kinerja (Studi terhadap Dosen pada Universitas Widyagama Malang)1790BaruStatus usulan:0707075301UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Ir. ISMINI MP.BURUH WANITA PEKERJA " Fresh Vegetables & Fruits Agribisnis " di PT RODEA MALANG ( Studi Mikro Analisis Gender dan Metode Proba untuk Mendukung Pengarustamaan Gender )1791BaruStatus usulan:0725106401UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:224

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADra. DHARMAYANTI PRI HANDINI MM.ANALISIS PROFIL DAN PERKEMBANGAN AKTIVITAS USAHA PEDAGANG DI OBYEK WISATA BATU1792BaruStatus usulan:0726016101UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:FITRI MARISA ST, MMMODEL DAN IMPLEMENTASI METODE ENKRIPSI KOMBINASI MD5 DAN SKRIP PENGOLAH STRING PADA FITUR LAYANAN PMB ONLINE1793BaruStatus usulan:0712027801UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Dra. DWI ANGGARANI Ak. MMPengaruh Fungsi Komunikator, Motivator, Fasilitator, Penyedia Pinjaman Dana, Pembina Warga Dan Pengawas Terhadap Persepsi Masyarakat Atas Badan/Lembaga Keswadayaan Masyarakat (B/LKM) Di Kota Malang1794BaruStatus usulan:0705026701UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:DEDI USMAN EFFENDY ST. MT.Model Perancangan Dan Pembuatan Streaming Radio Online Berbasis Android Mobile1795BaruStatus usulan:0714057904UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Ir. NAIF FUHAID M.M.PENGARUH BENTUK BLADE DAN HOUSING BLADE TERHADAP THRUST FORCE PADA HOVERCRAFT1796BaruStatus usulan:0724045301UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Ir. ENNY SUMARYATI MP.Kajian Aktivitas Antibakteri Ekstrak Angkak terhadap Pertumbuhan Bakteri Bacillus cereus dan Bacillus stearothermophilus1797BaruStatus usulan:0704015901UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:IRFAN FATONI SE. MSi.Analisis Keserasian Program Layanan Business Development Service - Provider (BDS-P) Dengan Peraturan Pemerintah terkait Pengembangan Usaha Mikro, Kecil dan Menengah (UMKM) Di Jawa Timur1798BaruStatus usulan:0723116901UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:Ir. AGUS SUYATNO M.T.ANALISIS CAMPURAN KoH DAN H2O TERHADAP PROSES PENYERAPAN CO2 PADA BIOGAS HASIL TERNAK DAN BIOGAS HASIL TEMPAT PEMBUANGAN SAMPAH (TPS)1799BaruStatus usulan:0730086001UNIVERSITAS WIDYAGAMA MALANG071030Penelitian Dosen PemulaKode:225

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANANG ARIS WIDODO S.Kom.PERANCANGAN DESAIN SISTEM INFORMASI AKADEMIK (SIAKAD) YANG TERINTEGRASI DENGAN UJIAN ONLINE MENGGUNAKAN METODE COMPUTERIZED ASSISTED TEST SERVICE (CATS) GUNA MENDUKUNG SISTEM AKADEMIK PADA UNIVERSITAS MERDEKA PASURUAN1800BaruStatus usulan:0702038102UNIVERSITAS MERDEKA PASURUAN071031Penelitian Dosen PemulaKode:TONI HERLAMBANGUpaya Memperkokoh Ekonomi Masyarakat Pinggiran Hutan melalui Model Peningkatan Daya Saing Sapi Lokal.1801BaruStatus usulan:0701016904UNIVERSITAS MUHAMMADIYAH JEMBER071032MP3EIKode:R ACHMAD EDIYANTOPeran Wanita Nelayan dalam Pemasaran Usaha Pembenihan Udang Skala Rumah Tangga di Kabupaten Jember1802BaruStatus usulan:0031126101UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ARI EKO WARDOYOPREDIKSI HARGA SEMBAKO MENGGUNAKAN ALGORITMA MEMETIKA DAN SCATTER SEARCH STUDI KASUS DI KABUPATEN JEMBER1803BaruStatus usulan:0014027501UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SAPTYA PRAWITASARIPENINGKATAN PERAN STRATEGIS WANITA TANI DALAM PEMBANGUNAN PERTANIAN MELALUI PELATIHAN ANAK TANI REMAJA (PATRA)1804BaruStatus usulan:0024057301UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SH MUHAMMAD IMAN MHPola Pelindungan Hukum Hak Cipta Terhadap Karya Seni Fotografi Berdasarkan UU No. 19 Tahun 20021805BaruStatus usulan:0011086501UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SUPRIYADIUpaya Peningkatan Loyalitas Pelanggan Rawat Inap Puskesmas Sumbersari Kabupaten Jember Berdasarkan Analisis Experiential Marketing1806BaruStatus usulan:0015047409UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:S.Psi PANCA KURSISTIN HANDAYANI M.APemetaan Problem-problem Psikologis Narapidana di Lapas Kelas IIA Jember1807BaruStatus usulan:0003037301UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:226

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs AGUNG MULJONO MMPENGARUH KEPEMIMPINAN TRANSAKSIONAL DAN KEPEMIMPINAN TRANSFORMASIONAL TERHADAP MOTIVASI DAN KINERJA DOSEN1808BaruStatus usulan:0007045501UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SITI NUR AINIPeran Dukun Gedhe Terhadap Pemahaman Family Planning Pada Perempuan Suku Tengger1809BaruStatus usulan:0012027701UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:S.Psi. NURLAELA WIDYARINI M.Si.Indigenous Health Belief Dhukun Gedhe Tengger sebagai Spiritual Resources Pendidikan Kesehatan Reproduksi Remaja1810BaruStatus usulan:0029057501UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:M HAMDI HSPERAN BIROKRASI PEMERINTAH DALAM MEWUJUDKAN GOOD GOVERNANCE DI KABUPATEN JEMBER1811BaruStatus usulan:0708028204UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ROFIATUL HIMAKONSTRUKSI HIBRIDITAS BAHASA SEBAGAI UPAYA PENGEMBANGAN BAHASA INDONESIA1812BaruStatus usulan:0702058402UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ELOK PERMATASARIAnalisis Strategi Bina Suasana dalam Pelaksanaa Kemitraan Bidan dan Dukun Bayi1813BaruStatus usulan:0707078702UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ENDANG GURITNOKontribusi Strategi Regulasi Emosi terhadap Kecenderungan Misconduct dan Ide Bunuh Diri pada Narapidana di Lapas Kelas IIA Jember 1814BaruStatus usulan:0710068104UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:HELMI SYAHBUANAAplikasi Penentuan Ilmu Nahwu pada Bahasa Arab Menggunakan Algoritma Stemming1815BaruStatus usulan:0714058004UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:227

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASASMIYANTOEfektifitas Paket Edukasi Postnatal (PEP) Terhadap Perilaku Optimalisasi Produksi ASI Pada Ibu Primipara Muda Di RSD. Dr. Soebandi Jember1816BaruStatus usulan:0716047902UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:MUHAMMAD AAN AULIQALAT PENGAMAN PENGGUNAAN GAS ELPIJI RUMAH TANGGA BERBASIS MIKROKONTROLLER 1817BaruStatus usulan:0715108701UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SYAMSUL HADIPemetaan Potensi Pemanfaatan Lahan Tidur (Marginal)Sebagai Upaya Pemberdayaan Ekonomi Masyarakatdi Kabupaten Jember1818BaruStatus usulan:0715037001UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:SUSI WAHYUNING ASIHAnalisis Perbedaan Kualitas Hidup Lanjut Usia di PSLU Kasiyan dan di Desa Mayang Berdasarkan Penerapan PRECEED PROCEDE Model1819BaruStatus usulan:0720097502UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ANWARKepuasan Nasabah Perbankan Syariah Atas Kualitas Layanan Jasa Islami (Kajian Berbasis Riset Pada Nasabah Bank Muamalat Di Kabupaten Jember, Bondowoso, Situbondo dan Banyuwangi)1820BaruStatus usulan:0719015502UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:NORITA CITRA YULIARTI SE. MMSTUDI PENERAPAN PSAK 45 YAYASAN PANTI ASUHAN YABAPPENATIM JEMBER1821BaruStatus usulan:0724077702UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:YUSRON ROZZAIDPengembangan Wirausaha Rumahan Bagi TKI Purna berbasis Produk Unggulan Daerah 1822BaruStatus usulan:0724037202UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:S.IP EDHI SISWANTO M.SiEFEKTIFITAS PERAN KEPALA DESA DALAM MEMBANGUN HARMONISASI MASYARAKAT GUNA MENINGKATKAN PARTISIPASI DALAM PEMBANGUNAN 1823BaruStatus usulan:0718036902UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:228

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr INSAN WIJAYA MPANALISIS EFISIENSI PEMASARAN TOMAT (Lycopersicon esculentum mill) BERBASIS JARING LABA-LABA DI KABUPATEN JEMBER1824BaruStatus usulan:0728086202UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:FAUZIYAHIdentifikasi Perizinan di Kabupaten Jember1825BaruStatus usulan:0711078102UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:KHOIRIYAHABA (Applied Behavior Analysis): Metode Pengoptimalan Kemampuan Komunikasi Anak Usia Dini Autis 1826BaruStatus usulan:0725116503UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:BAKTIAWAN NUSANTOIMPLEMENTASI KEBIJAKAN PEMERINTAH KABUPATEN JEMBER TERKAIT DENGAN PEMBERDAYAAAN MASYARAKAT (Studi Kasus di Badan Pemberdayaan Masyarakat)1827BaruStatus usulan:0708067601UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:Ir ELFIEN HERRIANTO MPKajian Biologi dan Ekonomi Fungsi Hutan Tangkapan Air di Lereng Gunung Argopuro1828BaruStatus usulan:0723055601UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:FITRIANA PUTRIMANAJEMEN NYERI PADA ANAK BERBASIS NURSING INTERVENTION CLASSIFICATION (NIC) 1829BaruStatus usulan:0704028101UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:S.Kp KOMARUDIN M.Kep.Sp.Kep.JPeran Perawat Pria sebagai Penopang Terwujudnya Pelayanan Keperawatan yang Berkualitas di RSD Balung, Kabupaten Jember 1830BaruStatus usulan:0708126803UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:DINA MERDEKA CITRANINGRUMKonstruksi Nilai Pendidikan dalam Teks Lagu Anak-anak Banyuwangi1831BaruStatus usulan:0717088701UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:229

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMOKH. HAIRUL BAHRI ST., MTKajian Potensi Energi Terbarukan Dari Blotong Dan Serbuk Kayu Sengon1832BaruStatus usulan:0717087203UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:YANNY TUHARYATIPola dan Karakteristik Kekerasan Dalam Rumah Tangga di Kabupaten Bondowoso1833BaruStatus usulan:0708017903UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:DEWI LUSIANAPENINGKATAN MENEJEMEN PENGETAHUAN PERUSAHAAN DILINGKUNGAN PERUSAHAN DAERAH PERKEBUNAN JEMBER BERBASIS BALANCED SCORECARD1834BaruStatus usulan:0712086702UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:YUNITA SATYA PRATIWIGangguan Gangguan pada Pekerja Las Listrik di Bengkel Las Listrik Desa Sempolan, Kecamatan Silo, Kabupaten Jember1835BaruStatus usulan:0702067102UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:CHRISTINE WULANDARI SURYA NPembelajaran Matematika Pada Anak Usia 0-3 tahun1836BaruStatus usulan:0717028302UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ST IRAWATI MTKajian Pemanfaatan Teknologi Bio Pori untuk Penanganan Genangan Air dan Banjir Perkotaan1837BaruStatus usulan:0702057001UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:ABADI SANOSRA SE,MMProduk Wisata, Bauran Pemasaran, Kondisi Lingkungan Pengaruhnya Terhadap Kepuasan dan Loyalitas Wisatawan (Studi Pada Pengunjung Pantai Pasir Putih Malikan Kabupaten Jember)1838BaruStatus usulan:0718077802UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:Ir SUHARTINAH MTANALISA PENGARUH PENERAPAN SISTEM MANAJEMEN KESELAMATAN DAN KESEHATAN KERJA (SMK3) TERHADAP KINERJA PERUSAHAAN JASA KONSTRUKSI DI KABUPATEN JEMBER 1839BaruStatus usulan:0719126201UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:230


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADENI ARIFIANTOPENENTUAN TOPIK DARI SEBUAH ABSTRAK TUGAS AKHIR MENGGUNAKAN JACCARD MEASURE1848BaruStatus usulan:0718068103UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:MOH HALIMTanggung Jawab Sosial Perusahaan, Ukuran Perusahaan dan Profitabilitas Pengaruhnya Terhadap Nilai Perusahaan (Studi Pada Perusahaan Manufaktur Yang Terdaftar di Bursa Efek Indonesia)1849BaruStatus usulan:0715108201UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:BUDI SANTOSOPENERAPAN GOOD CORPORATE GOVERNANCE DALAM UPAYA PENINGKATAN KINERJA ORGANISASI (Studi Empiris Pada Perguruan Tinggi Muhammadiyah di Jawa Timur)1850BaruStatus usulan:0709107301UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:LUH TITI HANDAYANISebaran Geografis Kejadian Kusta Dan Faktor Determinan Yang Mempengaruhi Tingginya Kejadian Kusta Di Kecamatan Sumberbaru 1851BaruStatus usulan:0701077604UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:Ir ARIEF NOOR AKHMADI MPKajian Senyawa Atraktan Bunga Selasih (Ocimum basilicum) sebagai Agen Pengendali Hama Busuk Buah1852BaruStatus usulan:0710036502UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:DIYAH PROBO WULANDampak Corporate Social Responsibility Terhadap Citra dan Loyalitas di Universitas Muhammadiyah Jember1853BaruStatus usulan:0730117603UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:IBNU SETYAWAN BUDI WICAKSONOAPLIKASI PEMBESARAN CITRA MENGGUNAKAN METODE NEAREST NEIGHBOUR INTERPOLATION1854BaruStatus usulan:0703068102UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:LUTHFI ALI MUHAROMPEWARNAAN PETA ADMINISTRASI KABUPATEN JEMBER MENGGUNAKAN GRAPH COLORING 1855BaruStatus usulan:0727108202UNIVERSITAS MUHAMMADIYAH JEMBER071032Penelitian Dosen PemulaKode:232





NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABAMBANG HARMANTO S.Pd, M.PdOptimalisasi teacher's questioning behaviors untuk membangun skemata mahasiswa dalam pre-reading activity1888BaruStatus usulan:0023087101UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:HADI SUMARSONO SE, M.M.KEUNGGULAN KOMPETITIF PERUSAHAAN KELUARGA ETNIS TIONGHOA PONOROGO1889BaruStatus usulan:0008057601UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:TITI RAPINI S.E, M.MPERAN WANITA DALAM MENJALANKAN BISNIS KELUARGA DI PONOROGO 1890BaruStatus usulan:0005056301UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:CHOLIK HARUN ROSJIDI A. Per. Pen, M.Kes.PERSEPSI, KESETARAAN SOSIAL EKONOMI PASANGAN SUAMI ISTERI DAN HUBUNGANNYA DENGAN FAKTOR RESIKO PENYAKIT KARDIOVASKULAR1891BaruStatus usulan:0022027201UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:SRININGSIHHubungan Ststus Gizi Ibu Hamil Trimester III dengan Berat Badan Bayi baru lahir Di Wilayah Puskesmas Balong Ponorogo1892BaruStatus usulan:0419094902UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:DWIATI MARSIWI SEANALISIS PENERAPAN BALANCE SCORECARD TERHADAP PENINGKATAN KINERJA LEMBAGAKEUANGAN MIKRO BERBASIS SYARIAH1893BaruStatus usulan:0003127202UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:EKY OKVIANA ARMYATIMODEL FAKTOR-FAKTOR YANG MEMPENGARUHI TINGGINYA TINGKAT PERCERAIAN DI KABUPATEN PONOROGO1894BaruStatus usulan:0705098003UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:ANA MAGHFIROH M.PdProblema Penumbuhan Minat dan Habit Berbahasa Inggris pada Mahasiswa Program Studi Pendidikan Bahasa Inggris 1895BaruStatus usulan:0727118203UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:237


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHERY ERNAWATIKesehatan Ibu Dan Bayi Pada Pernikahan Dini Di Kabupaten Ponorogo1904BaruStatus usulan:0711117901UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:LINA EMA PURWANTI S.Kep.NersPengaruh Self Help Group terhadap Efikasi Diri Pasien DM Tipe 2 Dalam Melakukan Perawatan kaki1905BaruStatus usulan:0730017702UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:WAWAN TRISNADI PUTRAPerencanaan Alat Pengolah Sampah Plastik Berkapasitas 1 Kg Plastik Kering Menjadi Bahan yang ramah lingkungan1906BaruStatus usulan:0720028003UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:OKI CAHYO NUGROHOProses Komunikasi Reyog Obyogan dalam Pelestarian Nilai-Nilai Budaya Ponoragan1907BaruStatus usulan:0728018304UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:ANNGA PRASETYOImplementasi Sistem Informasi electronik supply chain management untuk optimalisasi tata kelola obat pada logistik farmasi di rumah sakit umum aisyiah berbasis web1908BaruStatus usulan:0719088202UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:SAIFUL NURHIDAYATPREDIKSI FAKTOR RESIKO PENYAKIT KARDIOVASKULAR BERBASIS SEKOLAH1909BaruStatus usulan:0714127901UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:SUHARTIEFEKTIFITAS TERAPI MUSIK TERHADAP PENURUNAN NYERI KALA I PADA IBU INPARTU DIRUANG MELATI RSUD Dr HARJONO PONOROGO1910BaruStatus usulan:0719084901UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:UNTUNG WAHYUDIPengaruh Pemakaian Headset terhadap Radiasi Handphone pada Pengguna1911BaruStatus usulan:0713067902UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:239


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADra. KHUSNATUL ZULVA WAFIROTIN M.M,PERSEPSI KEUNTUNGAN MENURUT PEDAGANG KAKILIMA DI JALAN BARU KOTA PONOROGO1920BaruStatus usulan:0722056704UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:DIAN KRISTIANAImplementasi PBL(Problem Based Learning) Dengan penilaian Autentik Untuk Meningkatkan Motivasi Belajar Siswa Sekolah Dasar1921BaruStatus usulan:0727048502UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:DIYAH ATIEK MUSTIKA WATI M.HumCampur Kode dan Alih Kode Dalam Proses Pembelajaran Di Pondok Pesantren AL Mawaddah Ponorogo1922BaruStatus usulan:0725037901UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:NURUL SRI WAHYUNI S.Kep.,M.Kes.Pengetahuan Keluarga Tentang Perilaku Hidup Bersih Dan Sehat (PHBS) Tidak Merokok Di Dalam Rumah1923BaruStatus usulan:0707017503UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:LUTFIYAH DWI SETIAPENGUKURAN USABILITY APLIKASI SISTEM INFORMASI MANAJEMEN KOPERASI SYARIAH (SIMKOPSYAH) MENGGUNAKAN PARTIAL LEAST SQUARE1924BaruStatus usulan:0717038302UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:CHOIRUL HAMIDAH S.E, M.M.PENDAPATAN GANDA PETANI PENGGARAP DAN BURUH TANI DI KECAMATAN BABADAN DALAM UPAYA MEMPEROLEH AKSES PENGUASAAN LAHAN PERTANIAN1925BaruStatus usulan:0718046901UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:Dra. EKAPTI WAHJUNI DJUWITANINGSIH M.SiPOLA ASUH KELUARGA BESAR (EXTENDED FAMILY) TERHADAP TUMBUH KEMBANG ANAK ( Studi kasus penerapan pola asuh keluarga besar ( extended family) terhadap tumbuh kembang anak pada keluarga TKW di Desa Polorejo, Kecamatan Babadan,Kabupaten Ponorogo) 1926BaruStatus usulan:0722126101UNIVERSITAS MUHAMMADIYAH PONOROGO071044Penelitian Dosen PemulaKode:Ir. SUDARTO M.T.UJI APLIKASI DIRECT ANALYSIS METHOD (DAM) PADA ANALISIS STRUKTUR GEDUNG KOMPOSIT1927BaruStatus usulan:0006125601UNIVERSITAS SOERJO071045Penelitian Dosen PemulaKode:241

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI DINIARTIAKTUALISASI TEORI LEVEALED PREFERENCE DAN TEORI KARAKTERISTIK DALAM PEMANFAATAN PEKARANGAN1928BaruStatus usulan:0009055202UNIVERSITAS SOERJO071045Penelitian Dosen PemulaKode:NILAM RAMADHANIAnalisis Pola Asosiasi dan Sekuensial Data Rekam Medis RSUD Dr.H. Slamet Martodirdjo Pamekasan Dengan Teknik Data Mining Menggunakan Algoritma Apriori1929BaruStatus usulan:0719068001UNIVERSITAS MADURA071048Penelitian Dosen PemulaKode:Dra DIAH KARUNIA BINAWATI M.SiPENGARUH EKSTRAK KULIT DELIMA (Punica granatum) DAN RUMPUT TEKI (Cyperus rotundus) Terhadap Mortalitas Larva Nyamuk Aides aegypti1930BaruStatus usulan:0008046201UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:Drs SANTIKA RENTIKA HADI M.KesPAPARAN LOW LEVEL LASER PADA LATIHAN ANAEROBIK DALAM MENINGKATKAN JUMLAH SERABUT OTOT PUTIH DAN PENINGKATAN KAPASITAS KERJA ANAEROBIK1931BaruStatus usulan:0009026702UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:ANAK AGUNG SAGUNG ALIT W ST, MTPOLA PERMUKIMAN DESA PENGALANGAN DAN DESA LABAN KECAMATAN MENGANTI KABUPATEN GRESIK1932BaruStatus usulan:0713087601UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:ARTANTI INDRASETIANINGSIH S.Si, Pengembangan Mobile Learning Berbasis Flashlite Pada Mata Kuliah Statistika1933BaruStatus usulan:0723037602UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:TONY SUSILO WIBOWO SE, MPd, M.SMPENGARUH KARAKTERISTIK PEKERJAAN TERHADAPTURNOVER INTENTION PADA BEBERAPA RESTORAN MASAKAN ORIENTAL DI KOTA SURABAYA1934BaruStatus usulan:0722067702UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:NUNUNG NURYATIModel Pembelajaran Kooperatif-Konstrastif untuk Menguji Kesalahan Penerjemahan pada Mata Kuliah Translation Program Studi Bahasa Inggris 1935BaruStatus usulan:0726076301UNIVERSITAS PGRI ADI BUANA071049Penelitian Dosen PemulaKode:242

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAZAINI S.Pd, M.PdPENGEMBANGAN MODUL MATAKULIAH GEOMETRI EUCLID BERBASIS AKTIVITAS THINK PAIR SHARE UNTUK MENINGKATKAN BERFIKIR KRITIS MAHASISWA1936BaruStatus usulan:0704018301UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:HENA DIAN AYUAnalisis Sinyal Seismik Untuk Identifikasi Kantong Magma Dan Model Mekanisme Erupsi Gunungapi Ijen Jawa Timur1937BaruStatus usulan:0713098301UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:ALEXIUS ENDY BUDIANTO S.Kom, MMIMPLEMENTASI KOMPUTER MODERN PADA SMARTPHONE DENGAN PLATFORM ANDROID GUNA OPTIMALISASI PELAYANAN UMKM DI KABUPATEN MALANG1938BaruStatus usulan:0725116904UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:MOHAMMAD SULHAN S.T., M.KomSISTEM MONITORING DAN PENGENDALIAN KINERJA DOSEN PADA PROSES PERKULIAHAN BERBASIS RADIO FREQUENSY IDENTIFICATION (RFID) DI LINGKUNGAN UNIVERSITAS KANJURUHAN MALANG1939BaruStatus usulan:0702047901UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:IRMA TYASARI MMReview atas Penerapan SAK- ETAP Bab 22 Tentang Impairment Asset dalam Laporan Keuangan PDAM Kota dan Kabupaten Malang dengan Menggunakan Disclosure Index1940BaruStatus usulan:0726017601UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:ARINING WIBOWO S.Pd, M.PdPenerapan English Zone dan Pengaruhnya terhadap Kemampuan Speak English Siswa SD di Wilayah Kecamatan Sukun Kota Malang1941BaruStatus usulan:0709057303UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:SITI HALIMATUS SAKDIYAH S.Pd, M.PdSTRATEGI MEDIA GAMBAR DAN MODEL PEMBELAJARAN KANCING GEMERINCING1942BaruStatus usulan:0704086601UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:WIJI SETIYANINGSIH M.KomPenilaian Kinerja Tenaga PendidikDan Tenaga Edukatif Berdasarkan Dp3Sebagai Pendukung Penentuan Kenaikan GajiMenggunakan Metode Analytical Hierarchy Process(Studi Kasus : Kepegawaian Universitas Kanjuruhan Malang)1943BaruStatus usulan:0707028201UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:243

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAJU TJATUR NUGROHO K M.PPemanfaatan Kombinasi Ekstrak Buah Nanas dan Pepaya pada Konsentrasi dan Lama Perendaman yang Berbeda untuk Meningkatkan Kualitas Daging Itik Petelur Afkir1944BaruStatus usulan:0718026902UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:SALWA S.Pd., M.A.MENINGKATKAN KOMPETENSI PRAGMATIK MAHASISWA PRODI BAHASA INGGRIS UNIVERSITAS KANJURUHAN MALANG MELALUI MEDIA FILM1945BaruStatus usulan:0709097604UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:IVA NURDIANA NURFARIDA SE., MM.PERANAN KUALITAS LAYANAN DAN KEPUASAN PELANGGAN DALAM MEMBANGUN KEPERCAYAAN NASABAH BANK SYARIAH1946BaruStatus usulan:0708057502UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:AMAK YUNUS M.KomTEXT TO SPEECH BERBASIS NATURAL LANGUAGE PADA APLIKASI PEMBELAJARAN TENSES BAHASA INGGRIS1947BaruStatus usulan:0709057301UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:YULIANTIModel dan Perancangan Kantin Jujur Berbasis Entrepreneurship di Tingkat Sekolah Dasar (Studi Kasus Di SDN Panggungrejo 04 Jl. Panji - Kepanjen)1948BaruStatus usulan:0715028203UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:MARIA CHOLIFAH S.S.,M.PdPENINGKATAN KEMANDIRIAN DAN KEMAMPUAN MENULIS PARAGRAF MELALUI IMPLEMENTASI SELF EDITING DAN BUDDY EDITING DI UNIVERSITAS KANJURUHAN MALANG1949BaruStatus usulan:0724017801UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:HENNY LEONDRO M.KomOPTIMALISASI KEBERHASILAN INSEMINASI BUATAN MELALUI EFISIENSI KONSENTRASI SPERMATOZOA KAMBING PERANAKAN ETTAWA PER DOSIS SERTA KETEPATAN DEPOSISI SEMEN1950BaruStatus usulan:0729077201UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:AGUS SHOLEH S.Pd, M.PdModel Perancangan Pembelajaran Content-Based Approach Pada Mata Kuliah "Writing" Untuk Meningkatkan Ketrampilan Menulis Mahasiswa1951BaruStatus usulan:0717087101UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:244

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs TRIWAHYUDIANTO S.Pd M.SiFAKTOR-FAKTOR YANG MEMPENGARUHI SIKAP TERHADAP PENUNDAAN USIA PERKAWINANPADA REMAJA DI KABUPATEN MALANGTAHUN 20131952BaruStatus usulan:0723126001UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:MARIS KURNIAWATIJustifikasi Kadar Xanton Dalam Jus Kulit Manggis(Garcinia Mangostana L.) Dan Potensinya Terhadap Inhibisi α-Glukosidase dan Aktivitas Katalase Tikus yang Diinduksi Streptozotocin 1953BaruStatus usulan:0705037902UNIVERSITAS KANJURUHAN071050Penelitian Dosen PemulaKode:Drs SUPRAYITNO M.M.Orientasi Nilai Budaya Organisasi Atas Dasar Gender1954BaruStatus usulan:0004015602UNIVERSITAS GAJAYANA071051Penelitian Dosen PemulaKode:DEVI RAHMAYANTI S.T.,M.T.Studi Komparasi Penggunaan Teknik OOK-CDMA dan PPM-CDMA Untuk Menentukan Tingkat Kesalahan Bit (BER = BIT ERROR RATE) pada Jaringan Komunikasi Wireless Optik.1955BaruStatus usulan:0010067502UNIVERSITAS GAJAYANA071051Penelitian Dosen PemulaKode:MOHAMMAD MUDJIBSTUDI ANALISIS KINERJA BERBAGAI MACAM LAMPU HEMAT ENERGI (CFL)1956BaruStatus usulan:0725066302UNIVERSITAS GAJAYANA071051Penelitian Dosen PemulaKode:UMMU SA ADAHPengaruh Parenting Skill Orang Tua Terhadap Kebahagiaan Psikologi Anak1957BaruStatus usulan:0712028001UNIVERSITAS GAJAYANA071051Penelitian Dosen PemulaKode:- ACHMAD SETIAWAN S.T., M.T.Aplikasi BPF(Band Pass Filter) Digital Untuk Pendeteksian Sinyal AFSK (Audio Frequency Shift Keying) Pada Piranti RTTY (Radio Tele-Type)Portabel1958BaruStatus usulan:0726087002UNIVERSITAS GAJAYANA071051Penelitian Dosen PemulaKode:Dra DYAH KURNIAWATI M.SiFaktor-faktor Yang Mempengaruhi Kualitas Layanan Pasien Rumah Sakit Umum di Kota Madiun1959BaruStatus usulan:0713126601UNIVERSITAS KATOLIK WIDYA MANDALA MADIUN071053Penelitian Dosen PemulaKode:245

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHARIS WIBISONO S.E., M.Si., AkPengaruh Pengungkapan Corporate Social Responsibility (CSR) terhadap Biaya Modal Ekuitas dengan Asimetri Informasi sebagai Variabel Intervening1960BaruStatus usulan:0708077001UNIVERSITAS KATOLIK WIDYA MANDALA MADIUN071053Penelitian Dosen PemulaKode:Dr. BAGIYO SUWASONO S.T., M.T.Teknologi Pemurnian Garam Bertingkat dengan Pemanfaatan Aliran Fluida untuk Memenuhi Kebutuhan Garam Konsumsi dan Industri di Jawa Timur1961BaruStatus usulan:0723067002UNIVERSITAS HANG TUAH071056MP3EIKode:RUSNANI SE., MM.PENGARUH KEMISKINAN TERHADAP MENINGKATNYA KRIMINALITAS DI KABUPATEN SUMENEP1962BaruStatus usulan:0025066309UNIVERSITAS WIRARAJA071058Penelitian Dosen PemulaKode:DEDY ARFIYANTOPOLA PIKIR DAN TINDAKAN KEPALA DESA PEREMPUAN DALAM PEMBERIAN PELAYANAN KEPADA MASYARAKAT(STUDI PADA KEPALA DESA PEREMPUAN DI WILAYAH DARATAN KABUPATEN SUMENEP)1963BaruStatus usulan:0731077301UNIVERSITAS WIRARAJA071058Penelitian Dosen PemulaKode:FATMAWATIANALSIS EFISIENSI USAHATANI PISANG DAN STRATEGI PENGEMBANGANNYA DI KABUPATEN SUMENEP1964BaruStatus usulan:0712096802UNIVERSITAS WIRARAJA071058Penelitian Dosen PemulaKode:ASTRI FURQANIperilaku kepatuhan pajak pada wajib pajak orang pribadi(studi pada kpp pratama pamekasan)1965BaruStatus usulan:0711098102UNIVERSITAS WIRARAJA071058Penelitian Dosen PemulaKode:SUKARIS S.E., M.S.MCorporate Social Responsibility Berperspektif Gender1966BaruStatus usulan:0721087602UNIVERSITAS MUHAMMADIYAH GRESIK071059Penelitian Dosen PemulaKode:SYAMSUDDUHA SYAHRORINI ST,MTKadar Kesadahan Air Yang Aman Bagi manusia1967BaruStatus usulan:0008077001UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:246

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr SUMARNO MMDiagnosa Dini Penyakit Anemia Dengan Menggunakan Metode Dempster Shafer1968BaruStatus usulan:0727056103UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:EDI WIDODOOPTIMASI LAJU PERAMBATAN PELAPISAN CHROMMING UNTUK MENINGKATKAN KUALITAS KEKERASAN DAN KETAHANAN KOROSI BAJA ST 401969BaruStatus usulan:0704068004UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:ATIKHA SIDHI CAHYANAAlternative produk olahan wortel menjadi jeli sehat untuk meningkatkan nilai ekonomis petani wortel di jawa Timur1970BaruStatus usulan:0718107802UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:EKO AGUS SUPRAYITNO S,Si,MTRancang Bangun Phonocardiography beserta Analisa Sinyalnya Secara Realtime untuk Mendeteksi Kelainan Jantung Manusia Lebih Dini1971BaruStatus usulan:0713088702UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:AMELIA PRATIWIFAKTOR PENENTU PENGEMBANGAN LKM SYARIAH DI SIDOARJO DALAM MENINGKATKAN INKLUSI KEUANGAN BAGI PELAKU UMKM MEMASUKI ERA ASEAN ECONOMIC COMMUNITY 20151972BaruStatus usulan:0723067401UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:YULIAN FINDAWATIDesain Aplikasi Web Pengukuran kinerja Lembaga Keuangan Mikro menggunakan metode terintegrasi Fuzzy-AHP, WPM dan Balanced Scorecard guna mendukung pemberdayaan UMKM1973BaruStatus usulan:0725078301UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:ADE EVIYANTIDiagnosa Dini Penyakit Diabetes Menggunakan Metode Dempster Shafer berbasis Web1974BaruStatus usulan:0724057803UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:RIFQI RIDLO PHAHLEVY SH,MHPERLINDUNGAN HAK TENAGA KERJA ASING DI KABUPATEN SIDOARJO PASCA LAHIRNYA UNDANG-UNDANG NOMOR 6 TAHUN 20121975BaruStatus usulan:0718098302UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:247

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAARIF SENJA FITRANIDIAGNOSA DINI PENYAKIT GIGI DAN MULUT MENGGUNAKAN METODE DEMPSTER SHAFER1976BaruStatus usulan:0714097801UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:AKHMAD AHFASPeringatan Dini Untuk Keselamatan Pengendara Kendaraan1977BaruStatus usulan:0725026502UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:IZZA ANSHORY S.T., M.T.Penerapan PLC RTCU D4 Untuk Sistem Pencegah Kebakaran Rumah Berbasis SMS1978BaruStatus usulan:0709127501UNIVERSITAS MUHAMMADIYAH SIDOARJO071060Penelitian Dosen PemulaKode:AGUNG SUPROJO S.Kom., M.A.P.POLA KOMUNIKASI DAN STRATEGI POLITIK PARTAI POLITIK UNTUK MEMIKAT PEMILIH PEMULA PADA PILEG DAN PILPRES 20141979BaruStatus usulan:0727087301UNIVERSITAS TRIBHUWANA TUNGGA DEW I071061Penelitian Dosen PemulaKode:WIRAWANAplikasi penyalut edibel berbasis pati kulit pisang dengan penambahan natrium metabisulfit pada buah salak pondoh kupas1980BaruStatus usulan:0703098304UNIVERSITAS TRIBHUWANA TUNGGA DEW I071061Penelitian Dosen PemulaKode:Ir RIKAWANTO EKO MULYAWAN MPPERFORMANCE PASAR LELANG PADA SUB TERMINAL AGRIBISNIS (STA) MANTUNG KABUPATEN MALANG1981BaruStatus usulan:0717125602UNIVERSITAS TRIBHUWANA TUNGGA DEW I071061Penelitian Dosen PemulaKode:NONOK SUPARTINI SPt., MPProfil Produksi Dan Peternak Kemitraan Broiler Di Wilayah Gerbangkertasusila Sebagai Dasar Evaluasi Dan Pengembangan Kemitraan Broiler Jawa Timur1982BaruStatus usulan:0728017601UNIVERSITAS TRIBHUWANA TUNGGA DEW I071061Penelitian Dosen PemulaKode:CARMIA DIAHLOKA s.sos., msiPengaruh tayangan berita kriminal di televisi dan perilaku remaja1983BaruStatus usulan:0723087802UNIVERSITAS TRIBHUW ANA TUNGGA DEW I071061Penelitian Dosen PemulaKode:248



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAINUL MASRUROH SH, M.HiKEDUDUKAN AMIL ZAKAT PASCA KEPUTUSAN JUDICIAL REVIEW MAHKAMA KONSTITUSI ATAS UNDANG-UNDANG NO 23 TAHUN 2011 TENTANG PENGOLAHAN ZAKAT (STUDY ATAS PERAN BADAN AMIL ZAKAT DALAM PENGELOLAHAN ZAKAT SEBAGAI UPAYA PENANGGULANGAN KEMISKINAN)2000BaruStatus usulan:0713077902UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:ANA AMIROHKajian Peningkatan Kadar Kemanisan Melon (Cucumis melo L.) di Lahan Dataran Rendah.2001BaruStatus usulan:0714057203UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:IIB MARZUQIIMPLEMENTASI GAYA MENGAJAR AUDIO, VISUAL, DAN KINESTETIK (AVK) UNTUK MENGOPTIMALKAN KOMPETENSI MENULIS MAHASISWA PRODI PENDIDIKAN BAHASA DAN SASTRA INDONESIA FKIP UNISDA LAMONGAN2002BaruStatus usulan:0729088502UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:AGUS SUTIKNO SP, M.PKAJIAN PERTUMBUHAN TOMAT (licopersicon esculantum Mill.) TERHADAP PEMAKAIAN PUPUK ORGANIK CAIR DAN VARIETAS HIBRIDA2003BaruStatus usulan:0710066901UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:SE MUHAMMAD AZUS SHONY AZARDAMPAK PENERAPAN SISTEM MANAJEMEN MUTU (SMM) TERHADAP PERFORMA USAHA KECIL, DAN MENENGAH (UKM)(Studi Kasus pada UKM yang telah menerapkan SMM di Lamongan)2004BaruStatus usulan:0707027403UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:NOVI DARMAYANTIAnalisis Pembiayaan Musyarakah Terhadap perkembangan Usaha Mikro Pada Nasabah Bank Syariah Mandiri KCP Sumberrejo Kabupaten Bojonegoro Jawa Timur2005BaruStatus usulan:0707118301UNIVERSITAS ISLAM DARUL ULUM071062Penelitian Dosen PemulaKode:NURUL LAILI S.PdPengembangan Buku Saku dengan Metode Mnemonik dalam Pembelajaran Huruf Kanji Tingkat Dasar di SMA Darul Ulum 2 Unggulan BPPT CIC (Cambridge International Centre) Jombang2006BaruStatus usulan:0722038701UNIVERSITAS PESANTREN TINGGI DARUL ULUM071065Penelitian Dosen PemulaKode:SULUNG RAHMAWAN WIRAGHANIPendekatan Sistem Lean Manufacture Guna Mengidentifikasi Dan Mereduksi Waste UKM Pengecoran Logam.2007BaruStatus usulan:0708078503UNIVERSITAS PESANTREN TINGGI DARUL ULUM071065Penelitian Dosen PemulaKode:251



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEDY SUSANTOAnalisis Profil Asam Lemak Sosis Tersubstitusi Daging Babi2024BaruStatus usulan:0707108102UNIVERSITAS ISLAM LAMONGAN071067Penelitian Dosen PemulaKode:AGUS SUGIONOMAKNA PAJAK DAN RETRIBUSI : (PERSPEKTIF WAJIB PAJAK PEDAGANG KAKI LIMA KAWASAN SAE SALERA PAMEKASAN)2025BaruStatus usulan:0702087503UNIVERSITAS ISLAM MADURA071068Penelitian Dosen PemulaKode:TEGUH SARWO AJI SP., MMA.PENGARUH KENAIKAN HARGA FAKTOR PRODUKSI TERHADAP KELAYAKAN USAHA TEMPE DI KABUPATEN PASURUAN2026BaruStatus usulan:0728127601UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:KHOLID MURTADLO SE,MEModel Kelembagaan pemanfaatan lahan pertanian di kabupaten pasuruan2027BaruStatus usulan:0710077803UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:Ir. REKNA WAHYUNI MP.PENGARUH PENAMBAHAN KONSENTRAT PROTEIN DAUN KELOR TERHADAP SIFAT FISIKOKIMIA DAN ORGANOLEPTIK BERAS MOCAF2028BaruStatus usulan:0725046702UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:MISBACH MUNIR M.T.Pemodelan Standart Pelayanan Pasar Tradisional Berbasis Kepuasan Pengguna dalam Menghadapi Era Pasar bebas2029BaruStatus usulan:0708077702UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:GATOT BUDY PRASETIYO S.T., M.T.Pengurangan Getaran Mesin Diesel L-300 Dengan Menggunakan Pengubahan Pada Intake Manifold2030BaruStatus usulan:0711017301UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:NURAENI M.AB.PENGARUH UKURAN PERUSAHAAN, PROFITABILITAS DAN STRUKTUR KEPEMILIKAN TERHADAP CORPORATE SOCIAL RESPONSIBILITY DISCLOSURE (STUDI PADA PERUSAHAAN MANUFAKTUR YANG TERDAFTAR DI BEI)2031BaruStatus usulan:0721077802UNIVERSITAS YUDHARTA PASURUAN071069Penelitian Dosen PemulaKode:254




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANUR SOLIKINKonsepsi masyarakat kediri tentang pertanian berkelanjutan menuju katahan pangan nasional2056BaruStatus usulan:0707018002Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:AHMAD BAGUS SETIAWAN S.T., M.MSISTEM PENGENDALIAN PERSEDIAAN BAHAN BAKU MENGGUNAKAN METODE EOQ ( ECONOMIC ORDER QUANTITY ) DI SENTRA PRODUKSI KRUPUK KABUPATEN KEDIRI2057BaruStatus usulan:0703018704Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:BAMBANG SOENARKOPENINGKATAN NILAI KEPEDULIAN SOSIAL MELALUI MODIFIKASI MODEL PEMBELAJARAN KONSIDERASI PADA MAHASISWA TINGKAT I PROGRAM STUDI PGSD FKIP UNIVERSITAS NUSANTARA PGRI KEDIRI2058BaruStatus usulan:0704025601Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:BUDIMAN AGUNG PRATAMA S.Pd,.M.PdSURVEI PELAKSANAAN EVALUASI PEMBELAJARAN PENDIDIKAN JASMANI OLAHRAGA DAN KESEHATAN2059BaruStatus usulan:0706078801Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:ABDUL AZIZ HUNAIFIKarakteristik Masyarakat Jawa di Jawa Timur Dalam Mengungkapkan Emosi dan Kondisi Pikir2060BaruStatus usulan:0704078402Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:WAHID IBNU ZAMANPenerapan Teori Piaget Untuk Meningkatkan Prestasi Belajar Mahasiswa PGSD UNP Kediri Pada Mata Kuliah Pendidikan Matematika Materi Kubus Dan Balok2061BaruStatus usulan:0713078602Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:AGUS MUJI SANTOSO S.Pd,.M.SiMENINGKATKAN PRODUKSI SAPONIN Talinum paniculatum (Jacq) Gaertn (GINSENG JAWA) MELALUI OPTIMASI KONDISI KULTUR CAIR PEMBENTUK AGREGAT SEL2062BaruStatus usulan:0713088605Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:SITI AIZAHUPAYA MENURUNKAN STRES HOSPITALISASI DENGAN AKTIFITAS MEWARNAI GAMBAR PADA ANAK USIA 4-6 TAHUN DI RUANG ANAK RSUD GAMBIRAN KEDIRI2063BaruStatus usulan:0714047701Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:258

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJULI SULAKSONOSISTEM PAKAR PENENTUAN PENYAKIT GAGAL JANTUNG MENGGUNAKAN METODE NAÏVE BAYESCLASSIFIER2064BaruStatus usulan:0707076505Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:IRWAN SETYO WIDODOINVERSI WAVEFORM TIGA KOMPONEN UNTUK MENENTUKAN POLA BIDANG PATAHAN YANG BERKEMBANG DI PULAU JAWA MELALUI ANALISIS MOMEN TENSOR 2065BaruStatus usulan:0701098404Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:ARY PERMATA DENY NPERILAKU, KARAKTERISTIK, PERSEPSI MASYARAKAT TERHADAP BANK SYARIAH DI KARISIDENAN KOTA KEDIRI2066BaruStatus usulan:0704127901Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:LINA MARIANAcommunication strategies yang digunakan oleh pelajar dilingkungan kampung inggris pare dalam kegiatan speaking2067BaruStatus usulan:0710097401Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:AHMAD BASHRI S.Pd.,M.SiRESPON PERTUMBUHAN TANAMAN JARAK PAGAR ASAL KEDIRI TERHADAP CEKAMAN KEKERINGAN2068BaruStatus usulan:0707128202Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:FENY RITA FIANTIKA M.PdPemberdayaan Multimedia dan Peningkatan Hasil Belajar Materi Pecahan2069BaruStatus usulan:0710057801Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:KHOMSATUN NIMAHAPLIKASI TEOREMA POLYA UNTUK MENGHITUNG BANYAKNYA GRAF SEDERHANA YANG TIDAK ISOMORFIK2070BaruStatus usulan:0703018502Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:MOHAMMAD RIZAL ARIEFPENERAPAN FUZZY ANALITHYC HIERARCHY PROCESS (FAHP) UNTUK MENGANALISA TINGKAT KEPUASAN MAHASISWA TERHADAP PELAYANAN ADMINISTRASI PROGRAM STUDI2071BaruStatus usulan:0716027505Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:259

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAALFI LAILAPENINGKATAN KREATIVITAS MAHASISWA DALAM PEMANFAATAN BARANG-BARANG BEKAS PADA MATA KULIAH MEDIA PEMBELAJARANDI PGSD UNIVERSITAS NUSANTARA PGRI KEDIRI2072BaruStatus usulan:0708087703Universitas Nusantara PGRI Kediri071072Penelitian Dosen PemulaKode:IBNATU FAJRIL BAITIPengembangan Modul Bioreaksi Berpendekatan SETS (Sains, Environment, Technology, Society)2073BaruStatus usulan:0721058304UNIVERSITAS PGRI BANYUW ANGI071075Penelitian Dosen PemulaKode:ROSYID RIDHOPengaruh Remazol Yellow terhadap Efektivitas Fotoreduksi Ion Cr(VI) yang dikatalisis TiO2-Resin2074BaruStatus usulan:0707118205UNIVERSITAS PGRI BANYUW ANGI071075Penelitian Dosen PemulaKode:RENNA MAGDALENAPengaruh Transaksi Pihak Hubungan Istimewa Terhadap Nilai Badan Usaha yang Terdaftar di BEI Periode 2009 - 2012 2075BaruStatus usulan:0716108302Universitas Pelita Harapan Surabaya071077Penelitian Dosen PemulaKode:AMELIAPerspektif Kesejahteraan Masyarakat dalam Usaha Meningkatkan Peran Koperasi di Indonesia2076BaruStatus usulan:0715128701Universitas Pelita Harapan Surabaya071077Penelitian Dosen PemulaKode:LUSIA PERMATA SARI HARTANTIPERAN KEBIJAKAN EKSPOR PEMERINTAH TERHADAP PROSES INTERNASIONALISASI UMKM2077BaruStatus usulan:0717078402Universitas Pelita Harapan Surabaya071077Penelitian Dosen PemulaKode:WIDHY WAHYANI ST., MM.PENERAPAN CYBERPRENEURSHIP SEBAGAI UPAYA PENINGKATAN PEMASARAN PRODUK USAHA KECIL MENENGAH DI JAWA TIMUR 2078BaruStatus usulan:0011087501INSTITUT TEKNOLOGI ADHI TAMA SURABAYA072002Penelitian Dosen PemulaKode:DWI KHUSNA S.T., M.T.PENGARUH BEDA PUTARAN IMPELER POMPA TERHADAP UNJUK KERJA POMPA PARALEL2079BaruStatus usulan:0702017101INSTITUT TEKNOLOGI ADHI TAMA SURABAYA072002Penelitian Dosen PemulaKode:260



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr. SUKADI M.SiPOTENSI BIJI KARET SEBAGAI PENGGANTI KEDELAI UNTUK BAHAN PEMBUAT TEMPE BERGIZI DI KABUPATEN JEMBER 2096BaruStatus usulan:0724095701IKIP PGRI JEMBER072007Penelitian Dosen PemulaKode:ADZKIYAKIdeologi dan Perubahan Politik: Studi Historis tentang Peranan Ideologi Dalam Peristiwa Lahirnya Kabinet Parlementer Sutan Syahrir pada Masa Awal Kemerdekaan2097BaruStatus usulan:0710127801IKIP PGRI JEMBER072007Penelitian Dosen PemulaKode:- JOKO WIDIYANTO S.Pd, M.PdBiomonitoring Kualitas Air Sungai Madiun dengan Bioindikator Makroinvertebrata2098BaruStatus usulan:0616067505IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:SRI BUDYARTATIPENGEMBANGAN SKALA KETERAMPILAN SOSIAL MAHASISWA PGSD2099BaruStatus usulan:0507077103IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- HERMAWATI DWI SUSARI S.Psi, M.PdFenomena Pemajananan Lagu Dangdut Berlirik Seronok pada Perkembangan Imitasi Bahasa Anak (Kajian Sosiolinguistik dalam Konteks Kesantunan Berbahasa) 2100BaruStatus usulan:0712078006IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:PUJIATI S.Si., M.Si.Produksi Enzim Selulase Dari Kapang Selulolitik Hasil Isolasi Dari Tanah Hutan Jati Kresek Madiun 2101BaruStatus usulan:0715068601IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:ANGGITA LANGGENG WIJAYA S.E., M.SiANALISIS PERBEDAAN TINGKAT LIKUIDITAS BPR KONVENSIONALDAN BPR SYARIAH GUNA MENGETAHUI TINGKAT KESEHATAN KEUANGAN BANK PERKREDITAN RAKYAT (STUDI PADA BPR DI KABUPATEN MAGETAN DAN PONOROGO)2102BaruStatus usulan:0727078603IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- WASILATUL MURTAFIAH S.Pd, M.Pd.Pengembangan LKM (Lembar Kerja Mahasiswa) Berorientasi KKNI (Kerangka Kualifikasi Nasional Indonesia) untuk Penguatan Scientific Approach pada Mata Kuliah Persamaan Diferensial2103BaruStatus usulan:0702118601IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:263

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADHIKA PUSPITASARI S.HumPengembangan Buku Ajar Berbasis Budaya Lokal Mahasiswa Prodi PBSI IKIP PGRI Madiun2104BaruStatus usulan:0704038702IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- JEFFRY HANDHIKA S.Si, M.Pd.Pengembangan Media Pembelajaran Bermuatan Konflik Kognitif Untuk Mereduksi Miskonsepsi Pada Matakuliah Fisika Dasar2105BaruStatus usulan:0721068301IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- ELLYS MERSINA MURSIDIK S.Pd, M.PdANALISIS KEMAMPUAN BERPIKIR KREATIF SISWA SD DALAM MENYELESAIKAN MASALAH MATEMATIKA OPEN-ENDED DITINJAU DARI TINGKAT KEMAMPUAN MATEMATIKA2106BaruStatus usulan:0705038201IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- FATRIYA ADAMURA S.Pd, M.Pd.Pengembangan Perangkat Pembelajaran Kooperatif Berbasis Informasi Bermakna Materi Persamaan Diferensial Orde Dua untuk Melatihkan Kompetensi Guru Profesional 2107BaruStatus usulan:0731018701IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:PURWENI WIDHIANNINGRUMAKUNTANSI KETOPRAK: SEBUAH PENDEKATAN ETNOGRAFI MASYARAKAT SENI KETOPRAK DI PATI2108BaruStatus usulan:0724048402IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- TRI ANDARI M.PdPEMBELAJARAN MENGGUNAKAN PENDEKATAN QUANTUM LEARNING BERBASIS NEEDS ASSESMENT PADA MATA KULIAH ALJABAR LINIER MATERI RUANG-N EUCLIDES2109BaruStatus usulan:0726058402IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- MUH. WASKITO ARDHI S.Pd., M.Pd.IMPLEMENTASI GREEN LEARNING METHOD (GeLeM) DALAM PENGEMBANGAN BAHAN AJAR BERBASIS POTENSI LOKAL DI WANA WISATA GRAPE, KECAMATAN WUNGU, KABUPATEN MADIUN2110BaruStatus usulan:0725028401IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- SIGIT RICAHYONO S.S, M.Pd.Intercultural Place E-Branding (IPB) di Website Agen Wisata Provinsi DIY: Kajian Computer-Mediated Multimodal Discourse Analysis (CM_MDA)2111BaruStatus usulan:0712046901IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:264

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- ERMI ADRIANI MEIKAYANTI S.Pd.Penyimpangan Taksonomi Kategori Linguistik pada Surat Lamaran Kerja Mahasiswa IKIP PGRI Madiun (Studi Analisis Kesalahan Berbahasa)2112BaruStatus usulan:0703058701IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:DIAN RATNANINGTYAS AFIFAH S.Psi, M.PsiKematangan Sosial Anak Usia Dini Berkebutuhan Khusus di Kampung Idiot (Studi Kasus pada Anak Tunadaksa Usia 6 Tahun di Desa Sidoharjo, Kecamatan Jambon, Kabupaten Ponorogo)2113BaruStatus usulan:0705088402IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:FITRA PINANDHITA S.PdImplementasi Pairing Skype Dalam Meningkatkan Kemampuan Komunikasi dan Berbicara Mahasiswa Semester I IKIP PGRI Madiun2114BaruStatus usulan:0703098305IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:FIDA CHASANATUN S.Pd, M.Pd.multiple mind mapping sebagai strategi membaca referensi pada penulisan kajian pustaka program skripsi IKIP PGRI Madiun2115BaruStatus usulan:0707067101IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- SISKA DIANA SARI S.H, M.H.Internalisasi Nilai-Nilai Kearifan LokalDalam Pengembangan Buku Ajar Pendidikan Kewarganegaraan Di Perguruan Tinggi2116BaruStatus usulan:0701018402IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:LULUS IRAWATI S.S, M.PdImplementasi Sandwich Graphic Organizer untuk Meningkatkan Kemampuan Menulis Esei Mahasiswa Semester III IKIP PGRI Madiun2117BaruStatus usulan:0713047501IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:AGUNG NASRULLOH SAPUTRO S.Pd. M.Pd.PENGEMBANGAN BUKU AJAR MENULIS BERITA BERBASIS KARAKTER CINTA TANAH AIR SISWA KELAS VIII SMP NEGERI 1 MANTINGAN NGAWITAHUN PEMBELAJARAN 2014/20152118BaruStatus usulan:0715048601IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:DEWI TRYANASARI S.Pd, M.PdAnalisis Keterlaksanaan Implementasi Kurikulum 2013 di Kelas IV SD Se-Kabupaten Magetan2119BaruStatus usulan:0709088001IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:265

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- SRI UTAMI S.Pd, M.PdUJI EFEKTIFITAS EKSBIMA SEBAGAI SUBTITUTOR SIDABAS 500 SC TERHADAP HAMA THRIPS (Thrips sp.) PADA TANAMAN CABAI RAWIT( Capsicum frutescens L.) DI DESA KEDUNG PADANG KECAMATAN REJOSO-NGANJUK.2120BaruStatus usulan:0708127401IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- LUSIA KRISTIASIH DWI P S.S.Content and Language Integrated Leaning (CLIL)Pada Pembelajaran Bahasa Inggris Berbasis Kurikulum 2013: Studi Kasus di SMP Kota Madiun2121BaruStatus usulan:0709067201IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- IKA KRISDIANA S.Si, M.Pd.ANALISIS KESULITAN YANG DIHADAPI OLEH GURU DAN PESERTA DIDIK SEKOLAH MENENGAH PERTAMA DALAM IMPLEMENTASI KURIKULUM 2013 PADA MATA PELAJARAN MATEMATIKA (STUDI KASUS SE-KARESIDENAN MADIUN)2122BaruStatus usulan:0717118302IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- AGUS HARIWIBOWO ST.Pengaruh Media Simulasi Komputer Terhadap Aktifitas dan Kemampuan Mahasiswa Prodi PTE IKIP PGRI Madiun dalam Mearancang Sistem Kendali2123BaruStatus usulan:0716087001IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- ASRI MUSANDI WARAULIA S.Pd.PENGEMBANGAN BUKU AJAR MENULIS PUISI BERBASIS POTENSI DIRISISWA KELAS VIII SMP NEGERI 1 MANTINGAN NGAWITAHUN PEMBELAJARAN 2014/20152124BaruStatus usulan:0718118701IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:ROSITA AMBARWATI SS, M.PDPENGEMBANGAN MODUL PEMBELAJARAN MIKRO BERBASIS INSTRUCTIONAL APPROACH2125BaruStatus usulan:0713107501IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- ENI WINARSIH S.Pd, M.Pd.Inventarisasi Permainan Tradisional Jawa sebagai Sarana Pendidikan Karakter Dalam Pembelajaran Bahasa Indonesia Pada Siswa Sekolah Dasar 2126BaruStatus usulan:0719048401IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- BRIGITTA SEPTARINI RAHMASARI S.S, M.Pd.Implementasi KWL dalam Pembelajaran Membaca Intensif pada Mahasiswa Semester II IKIP PGRI Madiun2127BaruStatus usulan:0714098601IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:266

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADra. SITI MUHAYATI M.A.TANGGAPAN WARGA KOTA MADIUN PADA ZAKAT/JIZYAH SEBAGAI SUMBER APBN/APBD TERHADAP SIKAP MEMBAYAR ZAKAT/JIZYAH2128BaruStatus usulan:0710105702IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- ERLIK WIDIYANI STYATI S.Pd, M.Pd.IMPLEMENTASI EXPERENTIAL LEARNING DALAM PARAGRAF WRITING PADA MAHASISWA PENDIDIKAN BAHASA INGGRIS SEMESTER II IKIP PGRI MADIUN 2129BaruStatus usulan:0712128404IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:TYAS MARTIKA ANGGRIANA S.Psi, M.PdPERAN KONSELOR DI LUAR SEKOLAH (STUDI KEBUTUHAN KONSELOR DI PANTI REHABILITASI GELANDANGAN DAN PENGEMIS KOTA MADIUN)2130BaruStatus usulan:0730038504IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:NURUL KUSUMA DEWI S.Si., M.Sc.PRODUKSI BIOETANOL DARI Enhalus acoroides (L.f.) Royle (LAMUN TROPIKA)2131BaruStatus usulan:0726078502IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:- NURI ATININGSIH S.Pd. M.Pd.Implementasi Strategi Mengajar Gist (Generating Interaction between Scemata and Text) untuk Meningkatkan Kemampuan Membaca Teks Bahasa Inggris Ditinjau dari Aspek Kognitif Mahasiswa Pada Mahasiswa Pendidikan Bahasa Inggris Level Ekstensif IKIP PGRI Madiun2132BaruStatus usulan:0714027501IKIP PGRI MADIUN072010Penelitian Dosen PemulaKode:Drs. Ec. YAHYA M.MANALISIS LINGKUNGAN EKSTERNAL DAN STRATEGI MARKETING MIX UNTUK PENGEMBANGAN STRATEGI UMKM (Studi pada industri penghasil songkok di Kecamatan Kalitengah Kabupaten Lamongan)2133BaruStatus usulan:0715066601SEKOLAH TINGGI ILMU EKONOMI INDONESIA073001Penelitian Dosen PemulaKode:SULISTYO BUDI UTOMOPemanfaatan Smartphone untuk Membuat Bisnis Online bagi Mahasiswa di STIESIA Surabaya 2134BaruStatus usulan:0720027706SEKOLAH TINGGI ILMU EKONOMI INDONESIA073001Penelitian Dosen PemulaKode:Dra ENDAH SULISTYOWATI MSA.,AKConsumer Complaint Behavior (CCB) Pengguna Kartu JAMKESMAS Dalam Upaya Meningkatkat Layanan Fasilitas Kesehatan (Studi Pada umah Sakit Swasta dan RSUD di Jombang)2135BaruStatus usulan:0707046001SEKOLAH TINGGI ILMU EKONOMI INDONESIA073001Penelitian Dosen PemulaKode:267


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI HARIANI EKO WULANDARIModel Pembelajaran Matakuliah Humas Untuk Membentuk Kompetensi Profesi Public Relation Berbasis Teknologi Informasi2144BaruStatus usulan:0726017801STMIK SURABAYA073014Penelitian Dosen PemulaKode:I DEWA GEDE RAI MARDIANAELECTRONIC NOSE TEST UNIT UNTUK MENGIDENTIFIKASI KANDUNGAN BORAKS DALAM MAKANAN2145BaruStatus usulan:0715118003STMIK SURABAYA073014Penelitian Dosen PemulaKode:ACHMAD ARROSYIDIPembuatan Program Simulasi Algoritma Page Replacement pada Mata Kuliah Sistem Operasi dengan Menggunakan Microsoft Visual Basic2146BaruStatus usulan:0724077502STMIK SURABAYA073014Penelitian Dosen PemulaKode:RISTANTI AKSEPTORIEFEK CONTAGION DAN RECOVERY DARI KRISIS KEUANGAN GLOBAL PADA PASAR MODAL INDONESIA2147BaruStatus usulan:0717028601STMIK SURABAYA073014Penelitian Dosen PemulaKode:MADHA CHRISTIAN WIBOWOPenerapan Multi Layer Perceptron untuk Pengenalan Pola Tulisan Aksara Jawa2148BaruStatus usulan:0725098601STMIK SURABAYA073014Penelitian Dosen PemulaKode:ACHMAD BADRUN KURNIAPenerapan Realistic Mathematics Education dalam Pembelajaran Diagram Batang dan Garis Siswa SMP Kelas VII dengan Menggunakan Konteks Lokal2149BaruStatus usulan:0715078502STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:ANTORN WAHYUDIMELACAK JEJAK MAJAPAHIT MELALUI CERITA-CERITA MOJO DI JOMBANG SEBAGAI DOKUMEN SEJARAH2150BaruStatus usulan:0712048701STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:M. SYAIFUDDINDRAMATURGI MENGAJAR: SEBUAH PENERAPAN MODEL PEMBELAJARAN DENGAN PENDEKATAN ILMU DRAMA 2151BaruStatus usulan:0720058006STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:269

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFAHIMUL AMRIKEBERLANJUTAN USAHA INDUSTRI MANIK-MANIK DI DESA GAMBANG KECAMATAN GUDO KABUPATEN JOMBANG: FAKTOR-FAKTOR MANAJEMEN SUMBER DAYA MANUSIA2152BaruStatus usulan:0721098303STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:SAFIIL MAARIFPROFIL KOMUNIKASI MATEMATIKA TERTULIS SISWA MI DALAM MENYELESAIKAN MASALAH MATEMATIKA DITINJAU DARI GAYA BELAJAR SISWA2153BaruStatus usulan:0731078402STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:ESTY SARASWATI NUR HARTININGRPROSES BERPIKIR MAHASISWA DENGAN GAYA BELAJAR VISUAL DALAM MENGAJUKAN SOAL MATEMATIKA TIPE POST SOLUTION POSING2154BaruStatus usulan:0711078801STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:NOVITA NUR SYNTHIAWATIPENGARUH OLAHRAGA TRADISIONAL TERHADAP KEBUGARAN JASMANI SISWA(studi pada Siswa Kelas V SDN Gadingmangu 1 perak dengan SDN Gaingmangu 2 perak)2155BaruStatus usulan:0712118501STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:CHALIMAHKorelasi Antara Rasa Terima Kasih (Gratitude) Dengan Prestasi Sosial Akademik Mahasiswa Prodi Bahasa Inggris Angkatan 2013 Di STKIP PGRI Jombang 2156BaruStatus usulan:0728068301STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:RUKMININGSIHEFEKTIVITAS MODEL PEMBELAJARAN BERBASIS PORTOFOLIOPADA MATA KULIAH GRAMMAR DI PROGRAM STUDI BAHASA INGGRIS STKIP PGRI JOMBANG2157BaruStatus usulan:0703097402STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:IKA LUSI KRISTANTIParaton Mahasiswa STKIP PGRI Jombang dalam Wacana Berita2158BaruStatus usulan:0719118601STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:RITOH PARDOMUANPenerapan Aplikasi Metode Penilaian Pembelajaran Penjaskes Dalam Implementasi Kurikulum 2013 Di Sekolah Menengah Pertama Kelas VIISe-Kabupaten Jombang2159BaruStatus usulan:0703018703STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:270

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWARDANI DWI WIHASTYANANGActive Learning Melalui Learning Managemen System (LMS) untuk Meningkatkan Kompetensi Menulis Argumentatif Mahasiswa STKIP PGRI Jombang2160BaruStatus usulan:0702058501STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:TATIK IRAWATIJigsaw untuk Meningkatkankan Kemampuan Menulis Siswa SMPN 6 Jombang2161BaruStatus usulan:0703088003STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:BANU WICAKSONOVERBAL REPORT PROTOCOL SEBAGAI METODE IDENTIFIKASI STRATEGI PARAFRASE MAHASISWA PROGRAM STUDI PENDIDIKAN BAHASA INGGRIS STKIP PGRI JOMBANG2162BaruStatus usulan:0728127901STKIP PGRI JOMBANG073017Penelitian Dosen PemulaKode:Dra EMA SULISNANINGRUM Ak, MM“ PENGARUH FAKTOR – FAKTOR KEUANGAN TERHADAP KELENGKAPAN PENGUNGKAPAN LAPORAN KEUANGAN BERBASIS SAK ETAP PADA KOPERASI WANITA KOTA DAN KABUPATEN MALANG” 2163BaruStatus usulan:0702016001SEKOLAH TINGGI ILMU EKONOMI JAYA NEGARA073018Penelitian Dosen PemulaKode:SRI HARNANI SE, MMPENGARUH MOTIVASI DAN PELATIHAN TERHADAP PENINGKATAN KESEJAHTERAAN PENGRAJIN BORDIRDI DESA SUMBER PASIR KECAMATAN PAKIS KABUPATEN MALANG2164BaruStatus usulan:0716037101SEKOLAH TINGGI ILMU EKONOMI JAYA NEGARA073018Penelitian Dosen PemulaKode:IMAMA ZUCHROH B.Sc.,M.ComSOCIAL ENTREPRENEUR SEBAGAI CORE COMPETENCE, TINJAUAN DARI MARKETING PERSPEKTIF(Studi pada Social Entrepreneur Perajin Kain Perca Pelangi Nusantara, Pelanusa, Singosari, Malang)2165BaruStatus usulan:0726037402SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:DRA DWI DANESTY DECCASARI M.MANALISIS BANKING SERVICE QUALITY TERHADAP CITRA BANK SYARIAH DI KOTA MALANG2166BaruStatus usulan:0731036801SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:YUYUK LIANA SE., M.M.Peran Masyarakat Terhadap Posdaya (Pos Pemberdayaan Keluarga) Ditinjau Dari Motivasi, Persepsi, dan Empati Untuk Meningkatkan Kesejahteraan Keluarga Di Wilayah Malang Raya2167BaruStatus usulan:0709017101SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:271

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADRS EKO SUDJAWOTO M.MPERAN MODAL SOSIAL DALAM MENINGKATKAN CITRA PERGURUAN TINGGI (STUDI PADA STIE MALANGKUCECWARA MALANG)2168BaruStatus usulan:0719085901SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:LIDIA ANDIANI SE., M.M.Sistem Akuntansi Sederhana Sebagai Solusi Penyusunan Laporan keuangan Bagi UKM2169BaruStatus usulan:0726117001SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:RINI MARYUNI HARIYATI SE., Ak.,M.M.APLIKASI STANDART GICS DALAM PERSPEKTIF INTELLECTUAL CAPITAL TERHADAP KINERJA KEUANGAN DAN CAPITAL GAIN SEBAGAI ANALISIS UJI BEDA(Studi pada perusahaan manufaktur go public di Bursa Efek Indonesia)2170BaruStatus usulan:0712067003SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:Dra. LAILATUS SA ADAH M.Si.Faktor-Faktor Yang Mempengaruhi Praktik Perataan Laba Pada Perusahaan Manufaktur Yang Terdaftar Di Bursa Efek Indonesia 2171BaruStatus usulan:0705046901SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:ENGGAR NURSASI SE.,Ak, MMAnalisis Pengaruh Audit Tenure, Opinion Shopping, Leverage dan Pertumbuhan Perusahaan terhadap Penerimaan Opini Audit Going Concern Pada Perusahaan Perbankan dan Pembiayaan yang Go Public Di BEI2172BaruStatus usulan:0713097102SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:DYAH ARUNING PUSPITA SE., M.M, AkCARBON ACCOUNTING; APA, MENGAPA DAN SUDAHKAH BERIMPLIKASI PADA SUSTAINABILITY REPORTING? (Based On 2012’ PROPER With Gold Rank)2173BaruStatus usulan:0708057001SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:DRA LINDANANTY M.MDAMPAK PENURUNAN FRAKSI HARGA DAN SATUAN PERDAGANGAN SAHAM TERHADAP LIKUIDITAS PASAR (PERSPEKTIF INVESTOR DAN PERSPEKTIF KONSEPTUAL): STUDI PERISTIWA PENURUNAN FRAKSI HARGA DAN UKURAN LOT PER 6 JANUARI 2014 DI BURSA EFEK INDONESIA2174BaruStatus usulan:0720106603SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:SIWI DYAH RATNASARI S.E.,M.M.Pengaruh self confident dan self assessment terhadap performance appraisal dengan social skill sebagai variabel moderating2175BaruStatus usulan:0723087101SEKOLAH TINGGI ILMU EKONOMI MALANGKUCECW ARA073019Penelitian Dosen PemulaKode:272


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs. NURHADI MUYOTO M.PdPengembangan Multimedia Berbasis Counterbalanced pada Materi Klausa dalam Mengajar Gramatika TOEFL untuk Mahasiswa2184BaruStatus usulan:0026115402STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:SAIFUL RIFA IPengembangan Modul Essay Writing Berbasis Scientific Approach untuk Mahasiswa STKIP PGRI Blitar2185BaruStatus usulan:0723056001STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:RAINERIUS HENDRO PRASETIANTOPENGEMBANGAN MODUL COLLABORATIVE WRITING UNTUK MAHASISWA STRATA SATU2186BaruStatus usulan:0716125301STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:SURYANTI S.Si, M.PdIMPLEMENTASI STRATEGI POSE UNTUK MEMBERDAYAKAN CRITICAL THINKING MAHASISWA STKIP PGRI BLITAR PADA MATA KULIAH STRUKTUR ALJABAR I2187BaruStatus usulan:0703018002STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:ZEMMY INDRA KUMALA DEWIKEMAMPUAN KONEKSI MATEMATIK MAHASISWA TERHADAP MATERI MATRIKS DALAM MENYELESAIKAN MASALAH PADA CABANG ILMU STATISTIKA MATEMATIKA DAN PROGRAM LINIER2188BaruStatus usulan:0708058702STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:KRISTIANI S.Pd, M.PdPengembangan Bahan Ajar Geometri Dasar Berbasis Konstruktivis Yang Dapat Menumbuhkan Karakter Mahasiswa STKIP PGRI Blitar2189BaruStatus usulan:0714128002STKIP PGRI BLITAR073039Penelitian Dosen PemulaKode:FAJAR HENDRO UTOMO MTDeskripsi Komunikasi Matematika Berdasarkan Tingkat Berfikir Teori Van Hiele Pada Mata Kuliah Geometri Ditinjau dari Gaya Belajar Mahasiswa Program StudiPendidikan Matematika STKIP PGRI Tulungagung2190BaruStatus usulan:0705017201STKIP PGRI TULUNGAGUNG073040Penelitian Dosen PemulaKode:ARINA ROHMATIKAPENGGUNAAN AREL (ARGUMENT, REASONING, EVIDANCE AND LINK BACK) PADA PENYAMPAIAN ARGUMEN ENGLISH DEBATE DI ENGLISH DEBATE CLUB STKIP PGRI PONOROGO2191BaruStatus usulan:0713068401STKIP PGRI PONOROGO073044Penelitian Dosen PemulaKode:274

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHESTRI HURUSTYANTIRepresentasi Dunia Anak dalam Puisi-puisi Karyanya pada Harian Kompas Minggu Tahun 20132192BaruStatus usulan:0710116706STKIP PGRI PONOROGO073044Penelitian Dosen PemulaKode:BAMBANG SUPRIYATNO Drs. M.Si.PENDIDIKAN JURNALISTIK DAN PENGARUHNYA TERHADAP KEGIATAN CITIZEN JOURNALISM MAHASISWA DI NGAWI2193BaruStatus usulan:0710036403STKIP PGRI NGAWI073046Penelitian Dosen PemulaKode:ERNY UNTARI M.PD., M.PdEfektivitas model pembelajaran kooperatif tipe STAD dan NHT pada prestasi belajar matematika siswa ditinjau dari sikap siswa terhadap matematika 2194BaruStatus usulan:0717037602STKIP PGRI NGAWI073046Penelitian Dosen PemulaKode:RIDAM DWI LAKSONO S.Si., M.PEfektivitas Penggunaan gadget dalam pembelajaran menggunakan e-Learning2195BaruStatus usulan:0726088301STKIP PGRI NGAWI073046Penelitian Dosen PemulaKode:MOH. SUHAIDIHARMONI DALAM BERAGAMA (Studi terhadap Konstruksi Pemikiran Elit Agama dalam Mengelola Perbedaan Paham Keagamaan Menjadi Kekuatan Harmoni di Madura)2196BaruStatus usulan:0727068003STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:TRI SUKITMANKEKUASAAN PATRIMONIALISME POLITIK LOKAL; ANALISIS RELASI PATRON-KLIEN PADA PEMILIHAN KEPALA DESA AENG TONG-TONG SARONGGI SUMENEP2197BaruStatus usulan:0713028601STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:SALAMETISLAM DAN BUDAYA:TRADISI PENGAJIAN YASINAN KELILING DALAM PEMBINAAN KEAGAMAAN LANJUT USIA DI MADURA(STUDI TERHADAP PENGUATAN KEAGAMAAN DAN INTERAKSI SOSIAL MASYARAKAT DI SUMENEP)2198BaruStatus usulan:0711098103STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:ASAM PRAYITNO TAMYIS SANTOSOPENGEMBANGAN MODEL PEMBELAJARAN SILATURRAHMI BERBASIS BUDAYA SEBAGAI UPAYA MEREKONSTRUKSI MINAT, MOTIVASI, PRESTASI DAN KARAKTER SISWA MA DALAM PEMBELAJARAN MATEMATIKA2199BaruStatus usulan:0728127501STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:275

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJAMILAHPERAN GANDA PEREMPUAN PESISIR MELALUI PEMBERDAYAAN KEARIFAN LOKAL DI KABUPATEN SUMENEP ( STUDI TERHADAP PEREMPUAN NELAYAN DI SEKTOR PUBLIK)2200BaruStatus usulan:0726078104STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:MULYADIPerayaan Pernikahan Di Madura(Studi Terhadap Tradisi “Ompangan” Dalam Perayaan Pernikahan Yang mengakibatkan Hutang-Piutang Pada Masyarakat Sumenep)2201BaruStatus usulan:0719108203STKIP PGRI SUMENEP073051Penelitian Dosen PemulaKode:NUNGKY VIANA FERANITA ST., MMDampak Peristiwa Pemilu Presiden Indonesia 2014 terhadap Abnormal Return di Pasar Modal Indonesia2202BaruStatus usulan:0713048401SEKOLAH TINGGI ILMU ADMINISTRASI PEMBANGUNAN073058Penelitian Dosen PemulaKode:RATNA WIJAYANTITimeliness Sebagai Variabel Intervening Untuk Pengaruh Profitabilitas Dan Size Serta Pengaruh Leverage Terhadap Earnings Response Coeffisient (Erc)2203BaruStatus usulan:0714127201SEKOLAH TINGGI ILMU EKONOMI WIDYA GAMA073061Penelitian Dosen PemulaKode:NINIK LUKIANAPENGARUH BEBAN PAJAK, BUSINESS RISK DAN OWNERSHIP STRUCTURE TERHADAP STRUKTUR MODAL(Studi pada Perusahaan Manufaktur yang Listed di Bursa Efek Indonesia)2204BaruStatus usulan:0720016501SEKOLAH TINGGI ILMU EKONOMI WIDYA GAMA073061Penelitian Dosen PemulaKode:HESTI BUDIWATIPENGGUNAAN RASIO KEUANGAN CAMEL UNTUK MEMPREDIKSI KEPAILITAN DENGAN MENGGUNAKAN DISCRIMINANT ANALYSIS MODELS Z SCORE PADA BANK PERKREDITAN RAKYAT DI JAWA TIMUR2205BaruStatus usulan:0714047101SEKOLAH TINGGI ILMU EKONOMI WIDYA GAMA073061Penelitian Dosen PemulaKode:ERY HIDAYANTI SE, MM, MSA, AkPengaruh Good Corporate Governance Terhadap Manajemen Laba Riil Dengan Kualitas Audit Sebagai Variabel Pemoderasi2206BaruStatus usulan:0704127301SEKOLAH TINGGI ILMU EKONOMI WIDYA GAMA073061Penelitian Dosen PemulaKode:M. KHUSNI MUBAROKMETODE DAKWAH DALAM MENGATASI PROBLEMATIKA REMAJA2207BaruStatus usulan:0711118107STKIP PGRI SIDOARJO073064Penelitian Dosen PemulaKode:276


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUHAMMAD FASHIHULLISAN Model Pemberdayaan Dalam Penanggulangan Perilaku Seks Bebas Pelajar Di Pacitan 2216BaruStatus usulan:0721088302STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:SRI IRIYANTI M. Pd.BUDAYA LOKAL PACITAN “TETAKEN” SEBAGAI SUMBER BELAJAR (STUDI KASUS MAHASISWA PENDIDIKAN SEJARAH DI STKIP PGRI PACITAN)2217BaruStatus usulan:0722066401STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:AGUNG BUDI KURNIAWANIMPROVING MICRO TEACHING SKILLS THROUGH FACE THREATENING ACTS MANAGEMENT2218BaruStatus usulan:0715018603STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:ACHRORI M.SI.Fenomena Pernikahan Dini Di Desa Sono Kecamatan Tulakan Kabupaten Pacitan Jawa Timur2219BaruStatus usulan:0711074701STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:Dra. MARTINI M. Pd.GAYA KOMUNIKASI GURU DITINJAU DARI TEORI KOMUNIKASI LOGIKA DESAIN PESAN DAN IMPLIKASINYA TERHADAP PEMAHAMAN SISWA (Studi Kasus Pada Guru Pendidikan Kewarganegaraan SMP dan MTsdi Kabupaten Pacitan)2220BaruStatus usulan:0715126502STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:Drs. SUGENG SURYANTO M.Pd.IMPLEMENTASI PENDIDIKAN KARAKTER PADA SEKOLAH PELAKSANA KURIKULUM 2013 DI KABUPATEN PACITAN2221BaruStatus usulan:0710025602STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:KHOIRUL QUDSIYAHPengaruh Pembelajaran Matematika Model REOG Terhadap Kreativitas dan Kemampuan Analogi Matematis Siswa SMPN di Kabupaten Pacitan2222BaruStatus usulan:0709108201STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:AFID BURHANUDDIN Magister PendidikanDialektika Keilmuan Pondok Pesantren Tremas dalam Pemberdayaan Masyarakat Pacitan2223BaruStatus usulan:0704098301STKIP PGRI PACITAN073065Penelitian Dosen PemulaKode:278

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERMINATI PANCANINGRUMPengaruh Political Marketing Mix (Produk, Promosi, Harga, Tempat) Terhadap Keputusan Mahasiswa di Jombang yang Dimediasi Perilaku Pemilih2224BaruStatus usulan:0716097202SEKOLAH TINGGI ILMU EKONOMI PGRI DEW ANTARA073080Penelitian Dosen PemulaKode:MUHAMMAD YUSUF AZWAR ANASPENGARUH INDEPENDENSI AUDITOR, DAN GOOD CORPORATE GOVERNANCE TERHADAP KINERJA AUDITOR EKSTERNAL(STUDI PADA KAP DI JAWA TIMUR)2225BaruStatus usulan:0713047901SEKOLAH TINGGI ILMU EKONOMI WIDYA DHARMA073082Penelitian Dosen PemulaKode:AHMAD SAIFURRIZA EFFASAMotivasi dan Persepsi Sikap Mahasiswa Terhadap Keputusan Memilih Perguruan Tinggi di STIE Cendekia Bojonegoro2226BaruStatus usulan:0725058802SEKOLAH TINGGI ILMU EKONOMI CENDEKIA073089Penelitian Dosen PemulaKode:SYAIFULANALISIS DAN PERANCANGAN SISTEM DATABASE YANG TERINTEGRASI DI PONDOK PESANTREN NURUL JADID PAITON PROBOLINGGO2227BaruStatus usulan:0720087601SEKOLAH TINGGI TEKNOLOGI NURUL JADID073097Penelitian Dosen PemulaKode:SULISTIYANTO ST, MTSistem Informasi Geografis Pariwisata Kabupaten Probolinggo berbasis web2228BaruStatus usulan:0719117002SEKOLAH TINGGI TEKNOLOGI NURUL JADID073097Penelitian Dosen PemulaKode:ABDULLAH DASUQIEPengaruh Partisipasi Anggaran Terhadap Kinerja ManajerDengan Pengawasan Pimpinan Sebagai Variabel ModeratingPada Anak Perusahaan PT. Semen Indonesia Tbk.2229BaruStatus usulan:0704085901SEKOLAH TINGGI ILMU EKONOMI NU TRATE073098Penelitian Dosen PemulaKode:ENI FARIDA S.Ag., M.M.Analisis Pengaruh Motivasi, Kemampuan Kerja dan Jiwa Wirausaha Terhadap Keberhasilan Usaha Pada Sentra Industri Keripik Tempe Sanan Malang2230BaruStatus usulan:0714067301STMIK PPKIA PRADNYA PARAMITA073104Penelitian Dosen PemulaKode:INDAH DWI MUMPUNI S.kom, M.MAPLIKASI SISTEM INFORMASI GAJI BERBASIS WEB DI STMIK PPKIA PRADNYA PARAMITA MENGGUNAKAN PENDEKATAN DATA WAREHOUSE2231BaruStatus usulan:0715017701STMIK PPKIA PRADNYA PARAMITA073104Penelitian Dosen PemulaKode:279

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMALUQMAN AFFANDI S.Kom,MMSIREKAM MEDIK PASIEN BERBASIS HANDWRITING MENGGUNAKAN ANDROID2232BaruStatus usulan:0730118201STMIK PPKIA PRADNYA PARAMITA073104Penelitian Dosen PemulaKode:SIGIT SETYOWIBOWO S.T.PENGONTROLAN AKSES INTERNET MENGGUNAKAN MODEL OTOMATA DENGAN MEMANFAATKAN LOG PROXY SERVER DI STMIK PPKIA PRADNYA PARAMITA MALANG2233BaruStatus usulan:0718067401STMIK PPKIA PRADNYA PARAMITA073104Penelitian Dosen PemulaKode:NIA SARIANALISIS CLUSTER PERILAKU SEHAT ANAK JALANAN KOTA KEDIRI2234BaruStatus usulan:0720118001STIKES SURYA MITRA HUSADA073122Penelitian Dosen PemulaKode:NURWIJAYANTIREKAYASA DAUN SALAM UNTUK PENGAWETAN IKAN DALAM UPAYA MENGHINDARI PENGGUNAAN EFEK FORMALN TERHADAP KESEHATAN TUBUH.2235BaruStatus usulan:0704017601STIKES SURYA MITRA HUSADA073122Penelitian Dosen PemulaKode:BYBA MELDA SUHITAIdentifikasi Perkembangbiakan Bakteri pada pasien yang terpasang Endo Tracheal Tube (ETT) sebagai penyebab terjadinya Ventilator Assosiated Pneumonia (VAP) Di Ruang ICU 2236BaruStatus usulan:0707037901STIKES SURYA MITRA HUSADA073122Penelitian Dosen PemulaKode:HENRY SUDIYANTO S.Kp, M.KesPENGARUH PEMBERIAN POSISI TIDUR MIRING KANAN MIRING KIRI PADA PASIEN STROKE INFARK SELAMA FASE AKUT DENGAN TIRAH BARING TERHADAP TERJADINYA KONSTIPASI DI RSUD DR. WAHIDIN SOEDIROHUSODO2237BaruStatus usulan:0726046602SEKOLAH TINGGI ILMU KESEHATAN MAJAPAHIT073123Penelitian Dosen PemulaKode:IIS FATIMAWATI S.Kep.,Ns.,M.Kes.Analisis Faktor-Faktor Yang Mempengaruhi Terjadinya Resistensi Pada Klien Tb Paru Di RS. Saiful Anwar Malang2238BaruStatus usulan:0705048203SEKOLAH TINGGI ILMU KESEHATAN MAJAPAHIT073123Penelitian Dosen PemulaKode:NURUL MAWADDAH S.KepPemenuhan nutrisi pada 1000 hari pertama kehidupan dengan kejadian stunting pada balita di wilayah kerja puskesmas kedundung kota mojokerto2239BaruStatus usulan:0713048601SEKOLAH TINGGI ILMU KESEHATAN MAJAPAHIT073123Penelitian Dosen PemulaKode:280

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARINA NUR HIDAYATIEfektifitas peer group education tentang gizi seimbang terhadap perilaku gizi anak usia sekolah2240BaruStatus usulan:0711097602STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:ELIES MEILINAWATI SRIE BUDIHARAnalisis Keterkaitan Pola Asuh Orang Tua Dengan Knowledge dan Attitude tentang Kehamilan Remaja pada siswa SMA Negeri 1 Gondang Kabupaten Mojokerto 2241BaruStatus usulan:0706058401STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:LUTFI WAHYUNIstrategi koping dalam asuhan keperawatan terhadap respon psikologis penderita HIV-AIDS di poli VCT RSUD Prof Dr Soekandar Mojosari Kabupaten Mojokerto2242BaruStatus usulan:0709087801STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:DUWI BASUKI M.KepPENGARUH PELATIHAN SUPERVISI KEPALA RUANG TERHADAP KUALITAS PEMBERIAN OBAT INTRAVENA OLEH PERAWAT PELAKSANA2243BaruStatus usulan:0729087302STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:NANING PUJI SURYANTINIPENGARUH TAPEL TERHADAP AFTERPAIN PADA IBU POSTPARTUM2244BaruStatus usulan:0719058201STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:IFA ROIFAH M.KesAnalisis Pemodelan Keterkaitan Jumlah Anak Hidup Dan Usia Pertama Kawin dengan Kejadian unmet need 2245BaruStatus usulan:0703017501STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:INDAH KUSMINDARTIPRE EKLAMPSIA PADA IBU BERSALIN DENGAN KEJADIAN ASFIKSIA PADA NEONATUS(Studi Di RSUD RA Basoeni Gedeg Kab Mojokerto)2246BaruStatus usulan:0711077602STIKES BINA SEHAT PPNI MOJOKERTO073126Penelitian Dosen PemulaKode:NENI TRIANA S.Kep.NsPengaruh Pola Konsumsi Tinggi Serat Terhadap Pola Eliminasi Alvi Pada Anak Usia Sekolah (6-12Tahun) Di SDN Bendo I Kecamatan Pare Kediri2247BaruStatus usulan:0701047201STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:281

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADIDIT DAMAYANTI S.Kep.NsPENGARUH SIMULASI DISASTER MANAGEMENT TERHADAP KEMAMPUAN BERPIKIR KRITIS PADA MAHASISWA S1 KEPERAWATAN STIKES KARYA HUSADA KEDIRI SEBAGAI FASE PREPARADNESS OF DISASTER2248BaruStatus usulan:0723108401STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:DWI SETYORINI M.BiomedEfektifitas pemberian injeksi Metamizole secara intravena dengan mempercepat aliran infus terhadap nyeri saat injeksi dibandingkan dengan mematikan aliran infus 2249BaruStatus usulan:0704048101STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:SUMARMIATI SSTHubungan Sikap Ibu Hamil dengan Pelaksanaan Antenatal Care (K4) Sesuai Standar 12T di Puskesmas Kepung Kabupaten Kediri2250BaruStatus usulan:0708027102STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:QORINAH ESTININGTYAS S.S.TFaktor-faktor yang berhubungan dengan perilaku bidan dalam penapisan ibu hamil dengan faktor resiko HIV AIDS di Dinas Kesehatan kabupaten kediri 2251BaruStatus usulan:0705058101STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:MELANI KARTIKA SARI S.Kep.NsPengaruh Metode Pembelajaran Student Team Achievement Division (STAD) Pada Mata Kuliah Sistem Urologi Terhadap Peningkatan Prestasi Akademik Dan Kemampuan Sosialisasi Mahasiswa Keperawatan Dengan Perbedaan Suku Di STIKES Karya Husada Kediri2252BaruStatus usulan:0703018702STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:Ns. RATNA HIDAYATI M.Kep.Sp.MatPERSEPSI IBU POSTPARTUM YANG MENYUSUI DALAM MEMENUHI KEBUTUHAN NUTRISI SUATU STUDI ETHNOGRAPHY PADA SUKU JAWA 2253BaruStatus usulan:0705027101STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:DHINA WIDAYATI S.Kep.NsPENGARUH HOSPICE CARE TERHADAP KUALITAS HIDUP DAN MOTIVASI PADA PASIEN TERMINAL DALAM BERADAPTASI TERHADAP PENYAKIT DI RSUD GAMBIRAN KEDIRI2254BaruStatus usulan:0731038601STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:NIAN AFRIAN NUARI S.Kep.NsEfektifitas Metode Pranayama Breathing Untuk Menurunkan Nilai Peak Expiratory Flow Rate(PEFR) Dan Frekuensi Kekambuhan Pada Pasien Asma Bronkiale Di Wilayah Puskesmas Bendo Kediri2255BaruStatus usulan:0706048501STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:282

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- FARIDA HAYATI M.KepDampak Kebiasaan Menonton Televisi terhadap Kemampuan Interaksi Sosial Pada Anak Usia 5 – 6 tahun 2256BaruStatus usulan:0709037101STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:Ns. MOCHAMMAD MAFTUCHUL HUDA M.Kep. PENGARUH GOSKI (GIVING OF SALT KITCHEN) TERHADAP PROSES PENYEMBUHAN LUKA BAKAR DERAJAT II DANGKAL KARENA MINYAK GORENG PANAS PADA RATTUS NORVEGICUS2257BaruStatus usulan:0731056901STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:RENI YULIASTUTIK M.KesPengaruh Pemberian Makanan Yang Mengandung Phytoestrogen Terhadap Penurunan Keluhan Menopause 2258BaruStatus usulan:0714078001STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:ANDIKA SISWOARIBOWO S.Kep.NsModel Supportive Education Obedience Terhadap Regulasi Gula Darah Pada Penderita Diabetes Millitus Tipe II2259BaruStatus usulan:0722068402STIKES Karya Husada Kediri073128Penelitian Dosen PemulaKode:NOVIANA DESININGRUM S.Pd., M.Pd.Implementasi Online Learning Program (OLP) dengan Media Pembelajaran Berbasis Multimedia Untuk Meningkatkan Pemahaman Matakuliah Biologi Umum Pada Mahasiswa Program Studi Pendidikan Matematika STKIP Bina Insan Mandiri Surabaya2260BaruStatus usulan:0710128504STKIP BINA INSAN MANDIRI073129Penelitian Dosen PemulaKode:LILIN TURLINAPERINEAL MASSAGE DAN LATERAL POSITION UNTUK MENCEGAH ROBEKAN PERINEUM PADA IBU BERSALIN PRIMIPARA2261BaruStatus usulan:0728027801STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:SULISTIYOWATI M.KesPengaruh Infusum Kulit Manggis terhadap Penurunan Nyeri Dismenorea2262BaruStatus usulan:0715128501STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:IHDA MAULIYAH M.KesPengaruh Storytelling menggunakan finger puppet terhadap Higienitas Kuku pada anak Prasekolah2263BaruStatus usulan:0724078501STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:283

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADIAN NURAFIFAH M.KesPERBEDAAN EFEKTIFITAS BEKAM BASAH DAN KERING DALAM MENURUNKAN KADAR ASAM URAT DARAH PADA PENDERITA ASAM URAT (GOUT)2264BaruStatus usulan:0714088505STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:LILIS MAGHFUROH M.KesPeran Stimulasi Orang Tua Terhadap Perkembangan Bahasa Pada Anak Toddler Di Desa Mayangkawis Kecamatan Balen Bojonegoro2265BaruStatus usulan:0726068303STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:DIAH EKO MARTINI M.KepPengaruh Pemberian Terapi Musik Terhadap Respon Nyeri Tekanan Darah, Nadi, dan Respirasi Rate Ibu Bersalin Kala I2266BaruStatus usulan:0707038005STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:ANDRI TRI KUSUMANINGRUM M.KesPengaruh Pendampingan Bimbingan Menyusui dan Health Education Terhadap Keberhasilan Pemberian ASI Eksklusif Pada Ibu Post Partum2267BaruStatus usulan:0717078501STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:FARIDA JUANITAPengaruh Relaksasi Autogenic Training pada Ibu Postpartum terhadap Durasi Pemberian ASI Eksklusif2268BaruStatus usulan:0731108303STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:VIRGIANTI NUR FARIDA M.KepPengaruh Pemberian Cairan Infus Dengan NaCl Hangat Terhadap Kejadian Menggigil Pada Pasien Operasi Secsio Caesaria Di Kamar Operasi RS Aisyiyah Bojonegoro 2269BaruStatus usulan:0712128301STIKES MUHAMMADIYAH LAMONGAN073130Penelitian Dosen PemulaKode:M.Kep. YUSTINA KRISTIANINGSIHPELATIHAN TENTANG PENATALAKSANAAN FARMAKOLOGIS HIPERTENSI TERHADAP KETERATURAN MENGKONSUMSI OBAT ANTI HIPERTENSI2270BaruStatus usulan:0724107902STIKES KATOLIK ST VINCENTIUS A PAULO SURABAYA073133Penelitian Dosen PemulaKode:SISILIA INDRIASARI W M.Kep.Metode pembelajaran tutor teman sebaya (peer group) dalam meningkatkan kompetensi mahasiswa2271BaruStatus usulan:0705117801STIKES KATOLIK ST VINCENTIUS A PAULO SURABAYA073133Penelitian Dosen PemulaKode:284

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANs ARIEF WIDYA PRASETYA S.Kep, M.KepPengaruh Pemberian Jus Tomat Terhadap Elastisitas Vagina Pada Tikus Menopause2272BaruStatus usulan:0712037603STIKES KATOLIK ST VINCENTIUS A PAULO SURABAYA073133Penelitian Dosen PemulaKode:NEVY NORMA RENITYASPengaruh Pendidikan Kesehatan Kepada Lansia Terhadap Tingkat Kunjungan Posyandu Lansia2273BaruStatus usulan:0720038501STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:YENI KARTIKA SARIPengaruh Penerapan Ayah ASI (Breastfeeding Father) terhadap Produksi dan Pengeluaran ASI Pada Ibu Post Partum2274BaruStatus usulan:0709028401STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:ZAENAL FANANIAplikasi Kelas ibu Hamil Sebagai upaya Rekonstruksi Budaya "Tarak" (tidak makan makanan telur, ayam, daging, ikan) Pada Ibu Nifas di Kabupaten Blitar2275BaruStatus usulan:0710126503STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:ERNI SETIYORINIAplikasi Teknik 5S's (Swaddling, Side, Shushing, Swinging, Sucking) Terhadap Skala Nyeri dan Durasi tangisan Pada Neonatus Paska prosedur Invasif Pengambilan Darah2276BaruStatus usulan:0728128102STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:LEVI TINA SARIPengaruh Pijat Refleksi Terhadap Penurunan Tekanan Darah pada lansia dengan Hipertensi2277BaruStatus usulan:0711108103STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:MARIA ULFAPENGARUH PENYULUHAN TENTANG MENARCHE TERHADAP PENGETAHUAN DAN SIKAP REMAJA PUTRI PRA MENSTRUASI 2278BaruStatus usulan:0720128501STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:IKA AGUSTINAPENGARUH PENDIDIKAN KESEHATAN TENTANG KANKER PAYUDARA TERHADAP PENGETAHUAN DAN SIKAP REMAJA PUTRI TENTANGPEMERIKSAAN PAYUDARA SENDIRI (SADARI)2279BaruStatus usulan:0710088503STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:285

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATHATIT NURMAWATIPOTENSI WORTEL (DAUCUS CAROTA) SEDIAAN MENTAH DAN MATANG TERHADAP PENURUNAN KADAR KOLESTEROL TIKUS PUTIH (RATTUS NORVEGICUS)2280BaruStatus usulan:0710107903STIKES PATRIA HUSADA073135Penelitian Dosen PemulaKode:ELITA ENDAH MAWARNIPengaruh Penggunaan Media Bergambar terhadap Peningkatan Kemampuan Memahami Reproduksi Seks pada Siswa Tunarungu SMPLB 2281BaruStatus usulan:0708097502STIKES BANYUWANGI073137Penelitian Dosen PemulaKode:NUR HIDAYATINPengaruh Pendidikan dan Pelatihan Gizi terhadap Peningkatan Asupan Gizi Ibu yang Menyusui Bayi Usia 0-6 bulan di Puskesmas Licin, Banyuwangi 2282BaruStatus usulan:0701078502STIKES BANYUWANGI073137Penelitian Dosen PemulaKode:ATIK PRAMESTI WILUJENGPENGARUH SENAM OTAK (BRAIN GYM) TERHADAP PENURUNAN KADAR KORTISOL PADA ANAK USIA PRA SEKOLAH (3-5 TAHUN)YANG MENGALAMI KECEMASAN AKIBAT HOSPITALISASI DI RUANG ANAK RSUD BLAMBANGAN BANYUWANGI2283BaruStatus usulan:0730018504STIKES BANYUWANGI073137Penelitian Dosen PemulaKode:RAHAYU BUDI UTAMI S.Kep.Ns., M.Kes.PENGARUH PEMBERIAN PIJAT BAYI TERHADAP PEMENUHAN KEBUTAHAN TIDURPADA BAYI 6-12 BULAN DI POSYANDU KELURAHAN MANGUNDIKARAN NGANJUK2284BaruStatus usulan:0703127301STIKES SATRIA BHAKTI NGANJUK073138Penelitian Dosen PemulaKode:MARIA ANITA YUSIANAPotensi Senam Diabetes Melittus Terhadap Penurunan Kadar Gula Darah Puasa pada Pasien Diabetes Mellitus Tipe II di Wilayah Kerja Puskesmas Pesantren 1 Kediri2285BaruStatus usulan:0728057902STIKES RS BAPTIS KEDIRI073142Penelitian Dosen PemulaKode:ERLIN KURNIAPotensi Senam Lansia dalam Menurunkan Tekanan Darah Pada Lansia dengan Hipertensi di Kelurahan Bangsal Kota Kediri2286BaruStatus usulan:0718058301STIKES RS BAPTIS KEDIRI073142Penelitian Dosen PemulaKode:DEWI IKA SARI HARIPOERNOMOPOTENSI GUIDED IMAGERY MENURUNKAN TEKANAN DARAH LANSIA DENGAN HIPERTENSI DI RW II KELURAHAN BANGSAL KEDIRI2287BaruStatus usulan:0730127301STIKES RS BAPTIS KEDIRI073142Penelitian Dosen PemulaKode:286

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASUPRIHATINPEMBERIAN TOILET TRAINING OLEH ORANG TUA BERHUBUNGAN DENGAN FREKUENSI ENURESIS PADA ANAK USIA PRASEKOLAH (2-5 TAHUN) DI RW II KELURAHAN BANGSAL KECAMATAN PESANTREN KOTA KEDIRI2288BaruStatus usulan:0717086002STIKES RS BAPTIS KEDIRI073142Penelitian Dosen PemulaKode:WIWIK AGUSTINAHUBUNGAN ANTARA KECEMASAN PRIMIGRAVIDA DENGAN TERJADINYA KANDIDIASIS VULVOVAGINALIS DI BPS WIDIA HUSADA MALANG2289BaruStatus usulan:0701088201SEKOLAH TINGGI ILMU KESEHATAN MAHARANI073143Penelitian Dosen PemulaKode:YUNIAR ANGELIA PUSPADEWIImplementasi Olesan Jeruk Nipis (Citrus Aurantifolia) Untuk Mengurangi Striae Gravidarum dan Kelangsingan Perut Pada Ibu Nifas 2290BaruStatus usulan:0705048001STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:YULIYANIKPengaruh Posisi Lithotomi dan Posisi Dorsal Recumbent terhadap Derajat Perineum pada Ibu Bersalin Primipara2291BaruStatus usulan:0724076702STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:WIDYA DAMAYANTIEfektifitas Pemberian Minuman Jahe EkstrakTerhadap Hiperemesis Gravidarum Ringan 2292BaruStatus usulan:0709037102STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:RETNO HARJANTI HARTININGSIHProduksi Allicin Dari Bahan Ekstrak Bawang Putih “Lanang” (Allium Sativum) Untuk Mengendalikan Pertumbuhan Jamur (Candida Albicans) Pada Vagina2293BaruStatus usulan:0728106805STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:JIARTI KUSBANDIYAHPeran Hypnobirthing dan GentleBirth Saat Kelas Prenatal untuk Kenyamanan dan Kelancaran dalam Proses Persalinan di Polindes2294BaruStatus usulan:0704048201STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:NURMA AFIANIAnalisis Determinan Kualitas Hidup pada Pasien dengan Hipertensi Derajat II2295BaruStatus usulan:0730068402STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:287

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMIFTAKHUL ULFAPerbedaan social support dan personal happiness pada lansia di komunitas keluarga dan lansia di panti jompo2296BaruStatus usulan:0709078403STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:MISBAHUL SUBHITerapi untuk Gangguan Fobia Vektor (Kecoa) dan Rodent (Tikus) dengan Metode Spiritual Emotional Freedom Technique (SEFT)2297BaruStatus usulan:0717098403STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:ARI CHRISTIANAKulit Jeruk Untuk Aromaterapi dan Pengaruhnya Terhadap Penurunan Nyeri Haid 2298BaruStatus usulan:0701058501STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:TIWI YUNIASTUTI S.Si.,M.KesPengaruh Lipida Lemak Kedelai Terhadap Insiden Hipertensi, STIKES Widyagama Husada, Malang2299BaruStatus usulan:0722068002STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:MN LISAN SEDIAWANPenyusunan Strategi Peningkatan Kualitas Layanan (SERVQUAL) Bidan Praktik Mandiri dari Prespektif Ibu Hamil 2300BaruStatus usulan:0710037602STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:RUDY JOEGIJANTOROPERANCANGAN PROGRAM HOSPITAL PATIENT SAFETY MENGGUNAKAN QUALITY FUNCTION DEPLOYMENT (QFD)2301BaruStatus usulan:0715107102STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:WIRA DARAMATASIAKARAKTERISTIK PENGETAHUAN TENTANG LAKTASI DENGAN TEKNIK MENYUSUI PADA KALANGAN KADER POSYANDU DI KOTA MALANG2302BaruStatus usulan:0723107502STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:MUNTAHAPERAN MOTIVASI SPIRITUAL (HIMMAH) PETUGAS KESEHATAN DI RSI UNISMA TERHADAP PENCAPAIAN KINERJA”2303BaruStatus usulan:0708107901STIKES WIDYAGAMA HUSADA MALANG073145Penelitian Dosen PemulaKode:288


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEKA YUNI INDAH NURMALAAplikasi Pendekatan Peer Education pada Antenatal Class dalam Optimalisasi Kualitas Ibu Hamil2312BaruStatus usulan:0730068301Sekolah Tinggi Ilmu Kesehatan Kendedes073152Penelitian Dosen PemulaKode:RISKI AKBARANIEFEKTIFITAS PEMBERIAN VITAMIN A PADA IBU 24 JAM POST PARTUM TERHADAP PENINGKATAN STATUS GIZI BAYI DALAM RANGKA PENURUNAN ANGKA KEMATIAN BAYI2313BaruStatus usulan:0707098302Sekolah Tinggi Ilmu Kesehatan Kendedes073152Penelitian Dosen PemulaKode:INDAH MAULUDIYAHOPTIMALISASI KELOMPOK LANSIA DALAM STUDI BUDAYA JAWA : Peran Orang Tua Dalam pengenalan High Risk Pregnancy Sebagai Upaya Improve Maternal Health2314BaruStatus usulan:0723037706Sekolah Tinggi Ilmu Kesehatan Kendedes073152Penelitian Dosen PemulaKode:MARIA AGUNG HANIFAHHubungan Status Gizi dan Riwayat Pola Menstruasi Dengan Status Anemia Remaja Putri di SMA Negeri I Kandat Kabupaten Kediri2315BaruStatus usulan:0724078701STIKES Ganesha Husada Kediri073155Penelitian Dosen PemulaKode:TITIK JUWARIAHHubungan Perilaku Caring Perawat Dengan Tingkat Kepuasan Pasien Di Poli VCT RSUD. Gambiran Kota Kediri Berdasarkan Teori Caring Behaviour Menurut Watson2316BaruStatus usulan:0701067203STIKES Ganesha Husada Kediri073155Penelitian Dosen PemulaKode:EKO FACHTUR ROCHMANSistem informasi Rekam medis Elektronis Sebagai Pendukung Kompetensi Mahasiswa Rekam medis (Studi Kasus STIKes WCH)2317BaruStatus usulan:0725048402STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:HESTI AGUSTINA WIDYASTUTIPengaruh Pemberian Ekstrak Daun Sirsak Terhadap LAma Penyembuhan Luka Abrasio2318BaruStatus usulan:0718088403STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:AGUS WAHYO JATMIKOANALISIS HASIL RADIOGRAF ADENOID PADA PROYEKSI LATERAL NASOPHARYNX DENGAN TUTUP DAN BUKA MULUT PASIEN KLINIS HIPERTROFI ADENOID2319BaruStatus usulan:0724086805STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:290

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYUNITA RENY MUDIASARITingkat Keakuratan Kodefikasi Diagnosa Utama Rawat Inap Kasus Obsgyn Ditinjau dari Karakteristik Petugas di RS. Wava Husada Kepanjen 2320BaruStatus usulan:0711128402STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:SRI HAPSARI SUHARTONO PUTRIEfektivitas Pendidikan Gizi dengan Media Booklet Makanan Pendamping ASI (MP-ASI) dalam Meningkatkan Perilaku Pemberian MP-ASI2321BaruStatus usulan:0716098402STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:AHMAD RIFAITINJAUAN PELAKSANAAN DUAL CODING KASUS CEDERA DAN PENYEBAB LUAR CEDERA (EXTERNAL CAUSES) PADA KASUS GAWAT DARURAT DI RS WAVA HUSADA KEPANJEN2322BaruStatus usulan:0712108202STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:INDUNG SUSILO SEKTI KIRONOHUBUNGAN ANTARA KEJADIAN HIPERTENSI DENGAN DEMENSIA DIPOSYANDU LANSIA DESA NGASEM NGAJUM MALANG2323BaruStatus usulan:0701108006STIKES Widya Cipta Husada073156Penelitian Dosen PemulaKode:AZRIL OKTA ARDHIANSYAHPERBEDAAN PERILAKU MEROKOK DENGAN POLA ASUH DEMOKRATIS DAN POLA ASUH OTORITER PADA REMAJA DI DUSUN JETIS DESA WOTANNGAREKEC. KALITIDU KABUPATEN BOJONEGORO2324BaruStatus usulan:0706108004STIKES Insan Cendekia Husada Bojonegoro073158Penelitian Dosen PemulaKode:INDAH ROHMAWATIPENGARUH MEDITASI TERHADAP KOSENTRASI BELAJAR DITINJAU DARI KADAR HEMOGLOBIN (HB) MAHASISWA 2325BaruStatus usulan:0723077601STIKES Hutama Abdi Husada Tulungagung073159Penelitian Dosen PemulaKode:ANDRI MARDI SUSANTO S.E.,M.MAnalisis Tingkat Hunian dan Pendapatan Hotel di Kabupaten Jember selama Bulan Berkunjung ke Jember (BBJ)2326BaruStatus usulan:0730037301AKADEMI AKUNTANSI PGRI JEMBER074026Penelitian Dosen PemulaKode:NIKE NORMA EPRILIYANAAnalisa Tingkat Kepuasan Mahasiswa terhadap Program Sertifikasi Dosen melalui Kinerja Dosen Bersertifikasi pada Perguruan Tinggi Swasta di Kabupaten Jember 2327BaruStatus usulan:0705048504AKADEMI AKUNTANSI PGRI JEMBER074026Penelitian Dosen PemulaKode:291

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHADI JATMIKOPENGARUH EFEKTIFITAS DAN PRODUKTIFITAS PRAMUKAMAR DALAM MENINGKATKAN PELAYANAN HOTEL DI KABUPATEN JEMBER2328BaruStatus usulan:0702117803AKADEMI PARIW ISATA MUHAMMADIYAH JEMBER074030Penelitian Dosen PemulaKode:NUR HAMIM S.K.M., M.Kes.MODEL PENGARUH KEADILAN ORGANISASIONAL DAN QUALITY OF NURSING WORKLIFE TERHADAP KINERJA PERAWAT DALAM ASUHAN KEPERAWATAN DI RSUD KABUPATEN PROBOLINGGO.2329BaruStatus usulan:0706037103AKADEMI KEPERAWATAN HAFSHAWATY ZAINUL HASAN074045Penelitian Dosen PemulaKode:ROISAHPERAN PETUGAS TB DALAM PENEMUAN SUSPEK TB PARU KABUPATEN PROBOLINGGO2330BaruStatus usulan:0703087501AKADEMI KEPERAWATAN HAFSHAWATY ZAINUL HASAN074045Penelitian Dosen PemulaKode:Ns. RIESMI YATININGDYAH S.Kep, ANALISIS PEMBELAJARAN PRAKTIK KLINIK KEPERAWATAN MEDIKAL BEDAH DALAM UPAYA PENCAPAIAN KOMPETENSI MAHASISWA PADA ASUHAN KEPERAWATAN MEDIKAL BEDAH DI AKPER KERTA CENDEKIA SIDOARJO2331BaruStatus usulan:0725027901AKADEMI KEPERAWATAN KERTA CENDIKA SIDOARJO074052Penelitian Dosen PemulaKode:IMA RAHMAWATIPengaruh Massage punggung terhadap penurunan Nyeri Persalinan Kala I fase aktif dan Kecepatan pembukaan pada ibu bersalin di BPS Al-Hikmah , Jabon Kabupaten Mojokerto2332BaruStatus usulan:0714067101AKADEMI KEPERAWATAN BINA SEHAT PPNI MOJOKERTO074073Penelitian Dosen PemulaKode:BINARTI DWI WAHYUNINGSIHPengaruh Metode Pembelajaran Problem Based Learning terhadap Kemampuan Berfikir Kritis dalam mata ajar Keperawatan Medikal Bedah Mahasiswa semester III 2333BaruStatus usulan:0701067602AKADEMI KEPERAWATAN BINA SEHAT PPNI MOJOKERTO074073Penelitian Dosen PemulaKode:AGUS HARIYANTOPerbedaan efektifitas Relaksasi Benson dan Kompres Hangat dalam menurunkan nyeri sendi lanjut usia2334BaruStatus usulan:0730037001AKADEMI KEPERAWATAN BINA SEHAT PPNI MOJOKERTO074073Penelitian Dosen PemulaKode:ENY ASTUTI SKM,M.KesPengaruh Fisioterapi kepala terhadap pengurangan rasa nyeri pada klien hipertensi di RS.William Booth Surabaya2335BaruStatus usulan:0707065701AKADEMI KEPERAWATAN WILLIAM BOOTH SURABAYA074076Penelitian Dosen PemulaKode:292

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERNANIN DYAH WIJAYANTIEksplorasi Ekstrak Etanol Beberapa Tumbuhan Berpotensi sebagai Antiketombe2336BaruStatus usulan:0723118404AKADEMI FARMASI PUTERA INDONESIA MALANG074082Penelitian Dosen PemulaKode:MARIA MAGDALENA SETYANINGSIHPengaruh Kecepatan Penjepitan Tali Pusat pada Bayi Baru Lahir Normal yang Dilahirkan Secara Spontan oleh Ibu Primigravida Normal Terhadap Kejadian Hiperbilirubinemia 2337BaruStatus usulan:0712027004Akademi Keperawatan Panti Waluya Malang074097Penelitian Dosen PemulaKode:NURCAHYO BUDI WIBOWOPengaruh Status Gizi pada Wanita Usia Subur terhadap kejadian Pre-menstrual Sindrome2338BaruStatus usulan:0716096704Akademi Keperawatan Panti Waluya Malang074097Penelitian Dosen PemulaKode:UMI NARSIHFAKTOR-FAKTOR YANG MEMPENGARUHI TERJADINYA BERAT BADAN LAHIR RENDAH (BBLR) DI RSUD WALUYO JATI KRAKSAAN KABUPATEN PROBOLINGGO2339BaruStatus usulan:0708017504Akademi Kebidanan Hafshawaty Zainul Hasan Genggong074102Penelitian Dosen PemulaKode:SITI ZULAIKAHPENGARUH PEMBERIAN PIOGLITAZONE SEBAGAI AGONIS PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR γ ( PPARγ) TERHADAP PRODUKSI NITRIC OXIDE PADA KONDROSIT OSTEOARTHRITIS2340BaruStatus usulan:0723048004Akademi Analis Kesehatan Malang074108Penelitian Dosen PemulaKode:MOHAMMAD ADIBIdentifikasi senyawa aktif antimalaria dari ekstrak daun Calotropis gigantea dengan metode UV-Vis, FTIR, dan LCMS2341BaruStatus usulan:0719068105Akademi Analis Kesehatan Malang074108Penelitian Dosen PemulaKode:FAISALPengembangan Produk Herbal Terstandar Sebagai Obat Antimalaria dari Ekstrak daun Tanaman Bunga matahari (Helianthus annus)2342BaruStatus usulan:0710117901Akademi Analis Kesehatan Malang074108Penelitian Dosen PemulaKode:NUGROHO TRISTYANTOPENGARUH AGONIS PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR γ (PPARγ) TERHADAP PRODUKSI VASCULAR ENDOTHELIAL GROWTH FACTOR (VEGF) OLEH KONDROSIT OSTEOARTHRITIS2343BaruStatus usulan:0713068101Akademi Analis Kesehatan Malang074108Penelitian Dosen PemulaKode:293

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYUNIAWATI EKANINGRUMPENGARUH PELATIHAN PELAYANAN JASA TERHADAP KUALITAS PELAYANAN JASA KARYAWAN DI DESTINASI PARIWISATA SURABAYA (KEBUN BINATANG SURABAYA, TAMAN HIBURAN RAKYAT DAN MONUMEN KAPAL SELAM)2344BaruStatus usulan:0716067106POLITEKNIK NSC075002Penelitian Dosen PemulaKode:SHAFIQ NURDINAnalisis Strategi Bersaing Fresh Graduate D-3 (Diploma-3) Terhadap Peluang Kerja2345BaruStatus usulan:0709118204POLITEKNIK UNISMA MALANG075005Penelitian Dosen PemulaKode:ANA NURIL ACHADIYAHPERENCANAAN SOLAR TRACKER PHOTOVOLTAIC CELLS DENGAN METODE FUZZY LOGIC2346BaruStatus usulan:0709017503POLITEKNIK UNISMA MALANG075005Penelitian Dosen PemulaKode:MOCHAMAD NATSIRANALISIS PEMILIHAN ALTERNATIF TERBAIK RANCANG BANGUN MESIN PENGERING KRIPIK KENTANG2347BaruStatus usulan:0727055202POLITEKNIK UNISMA MALANG075005Penelitian Dosen PemulaKode:SUTOKOPerencanaan Generator Magnet Permanent Sebagai Generator Portable Untuk Digunakan Sumber Energi Peralatan Listrik Tegangan Rendah2348BaruStatus usulan:0718027601POLITEKNIK UNISMA MALANG075005Penelitian Dosen PemulaKode:AHLANAnalisis Pembuatan Odong-Odong Portable Untuk Semua Jenis Kendaraan Bermotor dengan Metode Binary Dominance Matrix2349BaruStatus usulan:0710067703POLITEKNIK UNISMA MALANG075005Penelitian Dosen PemulaKode:RAHMI SYARIFATUN ABIDAHPengaruh Pola Asuh Suku Madura Di Perantauan Terhadap Perkembangan Mental Sosial Balita Di Kelurahan Simolawang Simokerto Kota Surabaya2350BaruStatus usulan:0725127903POLITEKNIK KESEHATAN MAJAPAHIT075006Penelitian Dosen PemulaKode:TRI PENI M.Kes.Pengaruh Jus Kombinasi Air Kelapa Muda Dan Pisang Terhadap Tekanan Darah Penderita Hipertensi Yang Lanjut Usia Di Panti Wreda Mojopahit Mojokerto2351BaruStatus usulan:0709037703POLITEKNIK KESEHATAN MAJAPAHIT075006Penelitian Dosen PemulaKode:294

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANUR SAIDAH M.Kes.Pengaruh Karakteristik Keluarga dan pola asuh anak terhadap Sibling rivalry Pada Balita Usia Todler di Wilayah Kerja Puskesmas Putat Kecamatan Tanggulangin Sidoarjo2352BaruStatus usulan:0702057704POLITEKNIK KESEHATAN MAJAPAHIT075006Penelitian Dosen PemulaKode:SULIS DIANA M.Kes.Pengaruh terapi non farmakologi (yogurt, relaksasi nafasdalam dan seduhan teh rosella) terhadap penurunan tekanan darah pada ibu hamil hipertensi di RSUD Dr. Wahidin Sudiro Husodo Mojokerto2353BaruStatus usulan:0724047301POLITEKNIK KESEHATAN MAJAPAHIT075006Penelitian Dosen PemulaKode:FARIDA YULIANI S.ST., S.KM.Pengaruh Jus Bawang Bombay (Allium Cepa L) Terhadap Jumlah Sel Leydig Mencit (Mus Musculus) Model Diabetes Melitus2354BaruStatus usulan:0701078003POLITEKNIK KESEHATAN MAJAPAHIT075006Penelitian Dosen PemulaKode:EKO BUDI SANTOSOPENGARUH KECEPATAN PEMAKANAN DAN CAIRAN PENDINGINTERHADAP KEKASARAN MATERIAL DAN KEAUSAN MATA BORPADA PROSES DRILLING PADA BAJA SS 4002355BaruStatus usulan:0028047601POLITEKNIK SAKTI SURABAYA075007Penelitian Dosen PemulaKode:UCE INDAHYANTIPENGGUNAAN TECHNOLOGY ACCEPTANCE MODEL UNTUK MENGUKUR FAKTOR-FAKTOR YANG MEMPENGARUHI PENERIMAAN MAHASISWA POLITEKNIK SAKTI SURABAYA TERHADAP TEKNOLOGI LEARNING MANAGEMENT SYSTEM2356BaruStatus usulan:0711057103POLITEKNIK SAKTI SURABAYA075007Penelitian Dosen PemulaKode:SON HAJIAplikasi Particle Swarm Optimization (PSO) untuk Optimasi Parameter Kontroler PID pada Sistem Kendali Iklim Greenhouse 2357BaruStatus usulan:0713077702POLITEKNIK SAKTI SURABAYA075007Penelitian Dosen PemulaKode:I DEWA MADE HARI SHANDYStrategi UKM.Pengerajin Batik Tulis Dalam Memasarkan Batik Tulis Sidoarjo (Studi Kasus Pada UKM.Pengerajin Batik Tulis Di Desa Jetis-Kecamatan Sidoarjo2358BaruStatus usulan:0705107404POLITEKNIK SAKTI SURABAYA075007Penelitian Dosen PemulaKode:IKA YUNIWATIPengembangan Instrumen Penilaian Ranah Psikomotorik Mahasiswa Politeknik Negeri Banyuwangi Terhadap Matematika2359BaruStatus usulan:0723068701Politeknik Banyuwangi075011Penelitian Dosen PemulaKode:295




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs. I NYOMAN KARYAWAN M.M.Analisis Penampilan Pasar Bawang Merah di Kabupaten Lombok Barat2384BaruStatus usulan:0810055301UNIVERSITAS MAHASARASW ATI MATARAM081011Penelitian Dosen PemulaKode:LUH PUTU KUSUMAWARDANIPengaruh Pengetahuan dan Persepsi Masyarakat terhadap Kesadaran Masyarakat dalam Pengelolaan Kawasan Hutan Taman Wisata Alam Kerandangan di Kabupaten Lombok Barat 2385BaruStatus usulan:0829088101UNIVERSITAS MAHASARASW ATI MATARAM081011Penelitian Dosen PemulaKode:IDA AYU KETUT MARINIRAGAM AKTIVITAS EKONOMI WANITA NELAYAN TERHADAP PENINGKATAN PENDAPATAN RUMAH TANGGA NELAYAN DI KOTA MATARAM2386BaruStatus usulan:0804036501UNIVERSITAS MAHASARASW ATI MATARAM081011Penelitian Dosen PemulaKode:MUHSINEfisiensi Pemasaran Kakao di Kabupaten Lombok Utara2387BaruStatus usulan:0031126248UNIVERSITAS ISLAM AL-AZHAR MATARAM081012Penelitian Dosen PemulaKode:ZAINUL MUTTAQINKarakterisasi protein adhesin membran sel spermatozoa sapi bali2388BaruStatus usulan:0821046801UNIVERSITAS ISLAM AL-AZHAR MATARAM081012Penelitian Dosen PemulaKode:MUSANIPUji PCR Hasil Pemisahan Spermatozoa X dan Y Teknik Katoda Anoda secara in vitro2389BaruStatus usulan:0811106602UNIVERSITAS ISLAM AL-AZHAR MATARAM081012Penelitian Dosen PemulaKode:MUSNIASIH YUNIATIAnalisis Faktor-faktor Yang Mempengaruhi Keputusan Petani Bekerja Ke Kota "(studi kasus:tiga Desa di Kecamatan Labuapi Kabupaten Lombok Barat)”.2390BaruStatus usulan:0823066801UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:DESI SURYATIAnalisis Pengaruh Kondisi Sosial Ekonomi Keluarga Terhadap Pekerja Anak di Kabupaten Lombok Barat2391BaruStatus usulan:0825128002UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:299

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMEIYANTI WIDYANINGRUMPeranan Zakat Produktif Dalam Pemberdayaan Masyarakat Miskin(Studi Kasus Di Kota Mataram )2392BaruStatus usulan:0809057101UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:YEN KUSNITAUji Generasi Parasitoid telur Hadronotus leptocorisae Pada Telur Nezara Viridula 2393BaruStatus usulan:0811118101UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:NUNUNG SUSFITATINJAUAN YURIDIS TERHADAP FAKTOR-FAKTOR YANG MELATAR-BELAKANGI ISBAT PERKAWINAN PADA MASYARAKAT DI KECAMATAN SUMBAWA BESAR2394BaruStatus usulan:0828108002UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:RABIYATUL ADAWIYAHPengembangan Model Pembelajaran Berbasis Kemampuan Generik dalam Menulis Cerpen (Studi Classroom Etnography pada Siswa Kelas XI MAN 1 Mataram)2395BaruStatus usulan:0819098501UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:ROHMIATI AMINIAnalisis Pengaruh Partisipasi Masyarakat Dalam Proyek Pembangunan Masyarakat Pesisir(CCDP-IFAD) Terhadap Kemiskinan di Kabupaten Lombok Barat 2396BaruStatus usulan:0816026301UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:DIAN OCTAVIANA SAID SPt MSiPENGARUH PENAMBAHAN TEPUNG KACANG KORO PEDANG (CANAVALIA GLADIATA) TERHADAP KOMPOSISI KIMIA DAN NILAI ORGANOLEPTIK SOSIS SAPI2397BaruStatus usulan:0830108601UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:BAIQ SALKIAHPengaruh Faktor Kondisi Sosial Ekonomi dan Budaya TerhadapPelaksanaan Pernikahan Dini Dikalangan Remaja Puteri ( Studi Kasus di Kecamatan Kayangan Kabupaten Lombok Utara)2398BaruStatus usulan:0801017904UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:HULLYManajemen Mutu Pendidikan Islam di Madrasah Aliyah Negeri (MAN) 2 Mataram2399BaruStatus usulan:0831128204UNIVERSITAS NAHDLATUL WATHAN081014Penelitian Dosen PemulaKode:300



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAPAULINA ALIANDU STAnalisa Sentimen Pada Foursquare Untuk Penentuan Akomodasi, Lokasi Wisata Kuliner dan Belanja Menggunakan Metode Naive Bayes2416BaruStatus usulan:0829087901UNIVERSITAS KATOLIK WIDYA MANDIRA KUPANG081018Penelitian Dosen PemulaKode:NATALIA MAGDALENA RAFU MAMULAKRancang Bangun Sistem Informasi “Customer Relationship Management” Untuk Meningkatkan Kepuasan dan Mempertahankan Kualitas Pelayanan2417BaruStatus usulan:0828128502UNIVERSITAS KATOLIK WIDYA MANDIRA KUPANG081018Penelitian Dosen PemulaKode:PATRISIUS BATARIUS STSISTEM PENDUKUNG KEPUTUSAN PEMERINGKATAN GABUNGAN KELOMPOK TANI MENGGUNAKAN METODE ANALYTIC HIERARCHY PROCESS (AHP) 2418BaruStatus usulan:0815037801UNIVERSITAS KATOLIK WIDYA MANDIRA KUPANG081018Penelitian Dosen PemulaKode:PASKALIS ANDRIANUS NANI STIMPLEMENTASI ALGORITMA DJIKSTRA PADA PENCARIAN RUTE TERCEPAT MENUJU LOKASI-LOKASI WISATA DI KABUPATEN SUMBA BARAT DAYA BERBASIS SMS-GATEWAY2419BaruStatus usulan:0831038602UNIVERSITAS KATOLIK WIDYA MANDIRA KUPANG081018Penelitian Dosen PemulaKode:MAGDALENA NGONGOModel Pengembangan Ekowisata Bahari Whale Watching di Taman Nasional Perairan Laut Sawu, Nusa Tenggara Timur2420BaruStatus usulan:0012056009UNIVERSITAS KRISTEN ARTHA W ACANA081020MP3EIKode:ALYA ELITA SJIOEN SE, MMPelaksanaan Sistem Pemeriksaan Internal oleh Pemerintah Kabupaten di Provinsi Nusa Tenggara Timur dalam Penyelenggaraan Pengelolaan Keuangan Daerah yang Efisien, Efektif, Transparan dan Akuntabel2421BaruStatus usulan:0831018301UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:RUDOLF L A SAIN STPRancang Bangun dan Kalibrasi Alat Ukur Kadar Air Tanah Tipe Gypsum 2422BaruStatus usulan:0805026601UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:M ERLYN STEPHANIE LEDOProduksi Lipase Oleh Aspergillus niger Dengan Pemanfaatan Biji Kesambi (Schleichera oleosa) Sebagai Medium Melalui Solid State Fermentation2423BaruStatus usulan:0814078301UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:303

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMELKIANUS NUHAMARAIDENTIFIKASI MAE/ PORANG (Amorphophallus muelleri) DI KABUPATEN TTS SEBAGAI PANGAN ALTERNATIF YANG BERNILAI GIZI2424BaruStatus usulan:0814055801UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:MARTEN LUTER LANOPengaruh Beda Tinggi Muka Air Dan Panjang Pipa Lateral Pada Sistim Irigasi Tetes Pola Distribusi Tertutup Terhadap Hasil Irigasi2425BaruStatus usulan:0813106801UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:THERESIA MAGDALENA TAMELAN S.Pd., M.AppL.Analisis Keberadaan Jenis Adjektiva Dalam Bahasa Dela2426BaruStatus usulan:0816077901UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:HO EFIE CAHYANINGSIH S.Pd., M.Si.Pengaruh Jenis Kacang dan Lama Fermentasi terhadap Kandungan Protein dan Karakteristik Organoleptik Kaldu Nabati 2427BaruStatus usulan:0813016802UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:Dra DETHAN ERNIANI ORTALISJE M.ALPengaruh Latar Belakang Bahasa Indonesia terhadap Penggunaan Kolokasi Bahasa Inggris pada Mahasiswa Program Studi Bahasa Inggris UKAW2428BaruStatus usulan:0811107502UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:OVIE NINGSIH SPi, MSiANALISIS KELAYAKAN USAHA BUDIDAYA RUMPUT LAUT Kappaphycus alvarezii DI PERAIRAN BATUBAU DESA TESABELA KECAMATAN KUPANG BARAT, KABUPATEN KUPANG 2429BaruStatus usulan:0811107401UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:SEPRIANUS A NENOTEK SPd, MPdIMPLEMENTASI PENDIDIKAN KARAKTER DALAM BUKU" WHEN ENGLISH RINGS THE BELL" BERDASARKAN KURIKULUM 2013 (Studi Pada Buku Ajar Bahasa Inggris SMP Kelas VII Terbitan Kemendikbud RI Edisi 1 Tahun 2013)2430BaruStatus usulan:0811097501UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:LESYBETH MARLINA MALELAK N STP, M.SiPEMANFAATAN PATI GEWANG (Corypha gebanga) DALAM PENGOLAHAN MAKANAN BAIK BAGI ANAK-ANAK HINGGA ORANG DEWASA YANG MEMILIKI NILAI GIZI2431BaruStatus usulan:0807107301UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:304

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADINA ANTONETA NATONIS S.Pd., M.Pd.Peranan Dosen dalam Proses Bimbingan Skripsi Mahasiswa pada Program Studi Ilmu Pendidikan Teologi FKIP-UKAW Kupang. 2432BaruStatus usulan:0805127401UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:MESRI WELHELMINA NISRIANI MANAKUNTABILITAS DAN KINERJA: PERSPEKTIF PEMERINTAH DAERAH PROVINSI NUSA TENGGARA TIMUR2433BaruStatus usulan:0805058404UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:MAROMI MERLIN MBATE S.E., M.Sc.Analisis Kinerja Keuangan Bank Pembangunan Daerah dan Bank Perkreditan Rakyat di Nusa Tenggara Timur2434BaruStatus usulan:0804087601UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:ZET ENA SE, M.MHubungan Antara Belanja Sektor Pertanian, Pendidikan, Kesehatan dan Infrastruktur Pemerintah Kabupaten di Provinsi Nusa Tenggara Timur dengan Pendapatan per Kapita dan Indeks Pembangunan Manusia2435BaruStatus usulan:0821096701UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:Dra RENATE SIWUH BOLLA M.HumPEMBENTUKAN VERBA BAHASA DAYAK NGAJU KALIMANTAN TENGAH: TATARAN MORFOSINTAKSIS2436BaruStatus usulan:0822035601UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:JOLLYANES PETRECIA HOSANG LEDOMOTIVASI BELAJAR BAHASA INGGRIS MAHASISWA UNIVERSITAS KRISTEN ARTHA WACANA KUPANG 20142437BaruStatus usulan:0827076701UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:MELKIANUS NDAOMANU S.H., M.Hum.Evaluasi Pelaksanaan Penyusunan Prosedur dan Praktek-praktek Pengadaan Barang dan Jasa oleh Pemerintah Kabupaten di Lingkup Provinsi Nusa Tenggara Timur untuk Mendukung Good Governance2438BaruStatus usulan:0822106401UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:HERMYN B HINA SE.,M.SiPengaruh Fungsi Manajemen Pengelola terhadap Peningkatan Kinerja Non Finansial Koperasi Peternakan di Kabupaten Kupang 2439BaruStatus usulan:0825056801UNIVERSITAS KRISTEN ARTHA W ACANA081020Penelitian Dosen PemulaKode:305




NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYOSEFINA ANDIA DEKRITAANALISIS PENGARUH SUMBER DAN PENGGUNAAN DANA TERHADAP MODAL KERJA PADA KOPERASI SUBE HUTER MAUMERE2464BaruStatus usulan:0805076603UNIVERSITAS NUSA NIPA081025Penelitian Dosen PemulaKode:I PUTU DARMAWIJAYAIDENTIFIKASI FRAKSI AKTIF ANTIBAKTERI PADA DAUN PANCASONA (Tinospora coriaceae Beumee.).2465BaruStatus usulan:0826078201Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:YOHANES KRISTIANTOMODEL KOMPETENSI HOSPITALITY LANGUAGE PELAYAN RESTORAN PADA KAPAL PESIAR 2466BaruStatus usulan:0816057501Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:I GUSTI AYU WITA KUSUMAWATIPOTENSI ANTIOKSIDAN LOLOH TEMPUYUNG (Sonchus arvensis L.) SEBAGAI MINUMAN FUNGSIONAL2467BaruStatus usulan:0828118103Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:LUH MADE INDRIA DEWI S.Pd, M.PdEFEKTIVITAS PENGGUNAAN MEDIA PEMBELAJARAN VIDEO INTERAKTIF DENGAN SETING DISKUSI KELOMPOK KECIL UNTUK MENINGKATKAN KETERAMPILAN BERPIKIR KRITISPADA ANAK USIA DINI2468BaruStatus usulan:0816058802Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:NI KADEK DWIPAYANI LESTARIOptimalisasi Media Organik Untuk Perbanyakan Anggrek Hitam (Coelogyne pandurata Lindl.) Secara In Vitro 2469BaruStatus usulan:0802118601Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:NI WAYAN NURSINIISOLASI DAN KARAKTERISASI BAKTERI ASAM LAKTAT SUSU KAMBING KANDIDAT PROBIOTIK2470BaruStatus usulan:0828118102Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:IDA BAGUS AGUNG YOGESWARAPENGARUH PENAMBAHAN OKARA PADA SUSU KEDELAI FERMENTASI TERHADAP VIABILITAS PROBIOTIK Lactobacillus acidophillus FNCC 0051 SELAMA DI SIMULATED GASTROINTESTINAL JUICE SECARA IN VITRO2471BaruStatus usulan:0805018401Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:309

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAI GUSTI NGURAH ANOM CAHYADI PUSISTEM PENDUKUNG KEPUTUSAN PERHITUNGAN RENCANA ANGGARAN BIAYA PEMBANGUNAN RUMAH BERBASIS APLIKASI MOBILE2472BaruStatus usulan:0817038401Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:NI WAYAN DESWINIYANTISTUDI FERTILITAS HASIL PERSILANGAN ANGGREK HITAM (Coelogyne pandurata) DENGAN ANGGREK MUTIARA (Coelogyne asperata)2473BaruStatus usulan:0816128601Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:MADE AGUNG RAHARJASISTEM PREDIKSI INFLASI PROVINSI BALI MENGGUNAKAN ADAFTIVE NEURO FUZZY INFERENCE SYSTEM (ANFIS)2474BaruStatus usulan:0819098502Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:I MADE WISNU ADHI PUTRAPENURUNAN KONSENTRASI SENYAWA LINIER ALKILBENZENA SULFONAT (LAS) DALAM LIMBAH DETERGEN MENGGUNAKAN BIOSORBEN SERBUK CANGKANG TELUR AYAM2475BaruStatus usulan:0830088404Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:ANNY EKA PRATIWIKESIAPAN PEMBERI PELAYANAN KESEHATAN PRIMER DALAM PENYELENGARAAN JAMINAN KESEHATAN NASIONAL DI KABUPATEN BADUNG2476BaruStatus usulan:0819118601Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:I MADE ELIA CAHAYAIMPLEMENTASI METODE MASYARAKAT BELAJAR DALAM MENINGKATKAN KREATIVITAS ANAK USIA DINI2477BaruStatus usulan:0831126651Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:I KETUT SUARTANAKONTRIBUSI KOMPETENSI PEDAGOGIK DAN PROFESIONALGURUJASA BOGA TERHADAP MOTIVASI BELAJAR SISWA SMK 2478BaruStatus usulan:0810016501Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:I KETUT TUNASProgram Olahraga Seimbang meningkatkan Kecepatan, Ketelitian, dan Konstansi pada Lanjut Usia Desa Takmung Klungkung2479BaruStatus usulan:0831126727Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:310

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAI GEDE WIDHIANTARAKERAGAMAN GENETIK DNA MIKROSATELIT BURUNG JALAK BALI (Leucopsar rothschildi)2480BaruStatus usulan:0826128201Universitas Dhyana Pura081029Penelitian Dosen PemulaKode:RUDI HARIAWANIMPLEMENTASI PARENTING EDUCATION IN SCHOOL PADA JENJANG PENDIDIKAN DASAR DI LOMBOK TENGAH2481BaruStatus usulan:0605018401IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd SYAHRIR M.PdPengembangan Model Komik Matematika dalam Pembelajaran Sekolah Dasar2482BaruStatus usulan:0801128502IKIP MATARAM082003Penelitian Dosen PemulaKode:ADI CAHYADI S.PdPembuatan Bibit Bermutu Untuk Meningkatkan Produksi Rumput Laut Desa Labu Ijuk Kecamatan Moyo Hilir Sumbawa2483BaruStatus usulan:0807108402IKIP MATARAM082003Penelitian Dosen PemulaKode:IWAN DODDY DHARMAWIBAWA M.SiEFEK ANTIBAKTERI GOLONGAN ALLIUM TERHADAP BAKTERI MRSA2484BaruStatus usulan:0827097501IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pdi SUHARYANI M.PdMENANAMKAN SIKAP ENTREPRENEURSHIP MAHASISWA PENDIDIKAN LUAR SEKOLAH IKIP MATARAM MELALUI PRAKTEK MAGANG TH.20142485BaruStatus usulan:0824117301IKIP MATARAM082003Penelitian Dosen PemulaKode:IKA NURANI DEWI S.SiPENGEMBANGAN PANDUAN PRAKTIKUM FISIOLOGI TUMBUHAN I BERORIENTASI HEURISTIC TERBIMBING UNTUK MELATIH KEMAMPUAN BERPIKIR KRITIS MAHASISWA2486BaruStatus usulan:0825018202IKIP MATARAM082003Penelitian Dosen PemulaKode:CITRA AYU DEWIPengembangan Perangkat Pembelajaran CTL Berbasis Entrepreneurship pada Materi Elektrokimia2487BaruStatus usulan:0806068703IKIP MATARAM082003Penelitian Dosen PemulaKode:311

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASOEMARDIAWANMetode Latihan Reverse Curl dan Barbell Curl untuk Meningkatkan Power Lengan Pemain Bulutangkis di IKIP Mataram2488BaruStatus usulan:0813068402IKIP MATARAM082003Penelitian Dosen PemulaKode:TAUFIK SAMSURI S.PdUJI AKTIVITAS ANTIOKSIDAN DAN PENENTUAN KADAR ZAT GIZI PADA TEH GAHARU (Gyrinops versteegii (Gilg.) Domke)2489BaruStatus usulan:0812058401IKIP MATARAM082003Penelitian Dosen PemulaKode:MULIANIThe Acquisition Orders of the Agent-Oriented Modality Types in L2 English Postgraduate Program Students' Expressions2490BaruStatus usulan:0824048201IKIP MATARAM082003Penelitian Dosen PemulaKode:MASJUDINANALISIS KEMAMPUAN BERFIKIR GEOMETRI TUKANG BATA TRADISIONAL DALAM MENGHITUNG JUMLAH PRODUKSI BATA DI LOMBOK BARAT2491BaruStatus usulan:0807078602IKIP MATARAM082003Penelitian Dosen PemulaKode:ZUL ANWARPengembangan Modul Matakuliah Produksi Media Audio dan Radio Pembelajaran Untuk Meningkatkan Pemahaman dan Keterampilan Mahasiswa2492BaruStatus usulan:0831128218IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd ALUH HARTATIPENGEMBAGAN SELF ADVOCACY DALAM MENINGKATKAN KETERAMPILAN SOSIAL DENGAN STRUCTURE LEARNING APPROACH (SLA) PADA SISWA SMP2493BaruStatus usulan:0807118201IKIP MATARAM082003Penelitian Dosen PemulaKode:SRI NOPITA PRIMAWATI S.SiKurkumin Kunyit Putih (Curcuma zedoaria) Sebagai Imunomodulator Pada Mencit Balb/c Yang Diinfeksi Salmonella typhimurium2494BaruStatus usulan:0825118401IKIP MATARAM082003Penelitian Dosen PemulaKode:BAIQ ASMA NUFIDA S.Pd.PENINGKATAN POTENSI TANAH LIAT DARI TANAK AWU SEBAGAI ADSORBEN UNTUK PEMURNIAN MINYAK GORENG BEKAS2495BaruStatus usulan:0811068502IKIP MATARAM082003Penelitian Dosen PemulaKode:312


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAS.PdI SITI NURHIDAYATI M.PdPENGEMBANGAN KARAKTER MAHASISWA MENGGUNAKAN METODE TEAM QUIZ DISERTAI PENULISAN JURNAL BELAJAR PADA MATA KULIAH EVOLUSI2504BaruStatus usulan:0801098401IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd BAIQ ROHIYATUN M.PdUPAYA PENGEMBANGAN SDM DOSEN DI PERGURUAN TINGGI SWASTA SE-KOTA MATARAM2505BaruStatus usulan:0820028201IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd. SURYATI M.Pd.PENGEMBANGAN PEMBELAJARAN TERMOKIMIA BERBASIS INKUIRI TERBIMBING UNTUK MENINGKATKAN LITERASI SAINS SISWA2506BaruStatus usulan:0802038403IKIP MATARAM082003Penelitian Dosen PemulaKode:KAMARUDINTHE KNOWLEDGE OF SPEECH ACTS OF ENGLISH DEPARTMENT STUDENTS OF IKIP MATARAM2507BaruStatus usulan:0802038701IKIP MATARAM082003Penelitian Dosen PemulaKode:SRI YULIANTIPenggunaan LKS Melalui Penerapan Realistic Mathematics Education (RME) untuk Meningkatkan Pemahaman Konsep Matematika Siswa 2508BaruStatus usulan:0824078701IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd ITA CHAIRUN NISSAAnalisis Kemampuan Problem Solving Guru Matematika SMP Berdasarkan Standar PISA Sebagai Pendukung Implementasi Kurikulum 20132509BaruStatus usulan:0818068401IKIP MATARAM082003Penelitian Dosen PemulaKode:L. HABIBURRAHMANPEMBELAJARAN MENULIS KARYA ILMIAH BERORIENTASI TELEPON GENGGAM DENGAN MEMANFAATKAN TXT CONVERTER2510BaruStatus usulan:0810097901IKIP MATARAM082003Penelitian Dosen PemulaKode:LOVY HERAYANTIModel Pembelajaran Berbasis Masalah dengan Pendekatan Inkuiri untuk Meningkatkan Kreativitas Calon Guru Fisika2511BaruStatus usulan:0803068101IKIP MATARAM082003Penelitian Dosen PemulaKode:314

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAISMAIL EFENDI S.PdMengembangkan Keterampilan Sosial dan Karakter Peduli Lingkungan Serta Meningkatkan Kemampuan Kognitif Siswa Melalui Pembelajaran Kooperatif Tipe STAD2512BaruStatus usulan:0815088401IKIP MATARAM082003Penelitian Dosen PemulaKode:S.Pd TAUFIK SUADIYATNO M.PdThe Unique English of Souvenir Vendors in Lombok2513BaruStatus usulan:0823077801IKIP MATARAM082003Penelitian Dosen PemulaKode:AGUS MULIADI S.Pd.,M.Pd.Pengembangan Perangkat Pembelajaran IPA Berbasis Toleransi untuk Daerah Rawan Konflik2514BaruStatus usulan:0831128401IKIP MATARAM082003Penelitian Dosen PemulaKode:BQ. AZMI SUKROYANTI S.Pd., M.PdPengembangan Media Animasi Macromedia Flash Pada Materi Fisika Alat Optik 2515BaruStatus usulan:0804028801IKIP MATARAM082003Penelitian Dosen PemulaKode:YUSRAN KHERY S.Si.PENGARUH CONTEXT-RICH PROBLEMS TERHADAP KETERAMPILAN PROSES SAINS MAHASISWA DALAM PRAKTIKUM TITRASI ASAM BASA2516BaruStatus usulan:0814088501IKIP MATARAM082003Penelitian Dosen PemulaKode:GUSTI AYU MAHANAVAMI S.E, M.MPEMANFAATAN TOTAL BENCHMARKING DALAM MELAKUKAN PENGUJIAN KEPATUHAN WAJIB PAJAK DI INDONESIA (STUDI KASUS PADA SEKTOR MANUFAKTUR DI BURSA EFEK INDONESIA)2517BaruStatus usulan:0026057906SEKOLAH TINGGI ILMU MANAJEMEN HANDAYANI083002Penelitian Dosen PemulaKode:NI LUH PUTU AYU REONNINGRATKEPUASAN PELANGGAN TERHADAP CITRA PERUSAHAAN DAN SWITCHING BARRIER SERTA DAMPAKNYA TERHADAP LOYALITAS PELANGGAN INDUSTRI JASA ASURANSI DI BALI2518BaruStatus usulan:0815087901SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:Dra. DEWIWATI SUJADI MMMotivasi Sebagai Pendorong Efektivitas Pembelajaran Bahasa Prancis Pada Mahasiswa Pendidikan Tinggi Pariwisata di Bali2519BaruStatus usulan:0811036501SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:315

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANAK AGUNG KETUT SRIASIH SE.,MMMediasi Kepuasan Kerja Guru Pada Hubungan Konflik Peran, Stres Kerja Dan Komitmen Organisasi (Studi Pada SMK Pariwisata Triatma Jaya Badung, Tabanan, Dan Buleleng)2520BaruStatus usulan:0821037701SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:NI LUH PUTU AGUSTINI K SE., MM.Citra Destinasi, Moderating Effect Word-of-Mouth terhadap Intensitas Kunjungan Wisatawan ke Kintamani2521BaruStatus usulan:0803087303SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:MADE YUDI DARMITA SE.,MMIntegrasi Manajemen Mutu dan Manajemen Pengetahuan Sebagai Landasan Pembelajaran Organisasi Serta Pengaruhnya Terhadap Kinerja Perusahaan2522BaruStatus usulan:0803087301SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:I NENGAH ARISTANA SE.,MMKompetensi Sumber Daya Manusia Koperasi Di Kecamatan Klungkung2523BaruStatus usulan:0809098501SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:I PUTU BAGUS SUTHANAYA SE.,MMTingkat kepuasan kinerja karyawan berdasarkan Budaya organisasi dan Motivasi pada koperasi pasar di kabupaten Badung2524BaruStatus usulan:0828117001SEKOLAH TINGGI ILMU EKONOMI TRIATMA MULYA083009Penelitian Dosen PemulaKode:QIMYATUSSAADAHPengaruh Gender Klien dan Gender Auditor terhadap Audit Judgement (Sebuah Kajian Kuasi Eksperimen pada Kantor BPK Mataram)2525BaruStatus usulan:0821038401STKIP BIMA083012Penelitian Dosen PemulaKode:ASIATUNPENGARUH MODEL PEMBELAJARAN COOPERATIVE TIFE PICTURE AND PICTURE TERHADAP MOTIVASI DAN PRESTASI BELAJAR BIOLOGI PADA SISWA KELAS X- IPA SMA NW PANCOR TAHUN PEMBELAJARAN 2013-20142526BaruStatus usulan:0831127519STKIP HAMZANW ADI083013Penelitian Dosen PemulaKode:SHAHIBUL AHYANMeningkatkan Kemampuan Komunikasi dan Berpikir Kritis Matematis Mahasiswa melalui Problem Based Learning pada Mata Kuliah Geometri Transformasi Semester IV A Tahun Akademik 2013/20142527BaruStatus usulan:0816098601STKIP HAMZANW ADI083013Penelitian Dosen PemulaKode:316


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASYAHRUL AMAR M.PdUpaya Meningkatkan Aktivitas dan Hasil Belajar Mahasiswa Pada Mata Kuliah Sejarah Indonesia I Melalui Penerapan Model CTL Berbantuan Bahan Ajar2536BaruStatus usulan:0809046901STKIP HAMZANW ADI083013Penelitian Dosen PemulaKode:MUHAMMAD GAZALI M.PdEksperimentasi Model Pembelajaran Kooperatif Tipe Two Stay Two Stray Pada Materi Pokok Persamaan Garis Lurus Ditinjau dari Multiple Intelligences Siswa Kelas VIII SMP Di Kabupaten Lombok Timur Tahun Pelajaran 2013/20142537BaruStatus usulan:0828078701STKIP HAMZANW ADI083013Penelitian Dosen PemulaKode:ABDUL LATIFStatus Janda Dan Produktifitas Perempuan Sasak (Studi Kasus di Desa Mujur, Kecamatan Praya Timur, Kabupaten Lombok Tengah)2538BaruStatus usulan:0817026701STKIP HAMZANW ADI083013Penelitian Dosen PemulaKode:SAIFURRUHAIDIEVALUASI KEBIJAKAN BIDANG PARIWISATA PEMERINTAH PROVINSI NUSA TENGGARA BARAT 2539BaruStatus usulan:0829046702SEKOLAH TINGGI ADMINISTRASI MUHAMMADIYAH SELONG083014Penelitian Dosen PemulaKode:IKSAN S.Pd.IPERSEPSI UMAT ISLAM TERHADAP SYARIAT ISLAM DAN DEMOKRASI DAMPAKNYA TERHADAP TOLERANSI ANTAR UMAT BERAGAMA DI KOTA BIMA2540BaruStatus usulan:0818048202SEKOLAH TINGGI ILMU HUKUM MUHAMMADIYAH BIMA083017Penelitian Dosen PemulaKode:NASRUDDINPENERAPAN CUSTOMER CENTRIC DI SEKOLAH TINGGI TEKNIK LINGKUNGAN MATARAM : BERBASIS KONSUMEN INTERNAL DAN EKSTERNAL2541BaruStatus usulan:0810117202SEKOLAH TINGGI ILMU ADMINISTRASI MATARAM083018Penelitian Dosen PemulaKode:Drs. MUHAMMAD YAMIN MMPRAKTIK PENGHINDARAN PAJAK PERUSAHAAN DI INDONESIA2542BaruStatus usulan:0817085201SEKOLAH TINGGI ILMU ADMINISTRASI MATARAM083018Penelitian Dosen PemulaKode:Sarjana MUHAMMAD YUNUS S.KOM KomputerSistem Prediksi Kelulusan Mahasiswa (Studi Kasus di STMIK Bumigora Mataram)2543BaruStatus usulan:0831128607STMIK BUMI GORA083019Penelitian Dosen PemulaKode:318

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANDRIS FAESALRANCANG BANGUN MEDIA PERANGKAT BANTU PEMBELAJARAN BERBASIS E-LEARNING UNTUK MATA KULIAH PEMROGRAMAN2544BaruStatus usulan:0821068601STMIK BUMI GORA083019Penelitian Dosen PemulaKode:KARTARINA S.KOMANALISIS NILAI RISIKO DENGAN VALUE AT RISK (VaR)MENGGUNAKAN METODE GENERALIZED PARETO DISTRIBUTION (GPD) UNTUK MEMPREDIKSI RETURN INVESTASI2545BaruStatus usulan:0810087701STMIK BUMI GORA083019Penelitian Dosen PemulaKode:DIAN SYAFITRI CHANI SAPUTRIPemanfaatan Augmented Reality Untuk Promosi Produk Gerabah Lombok2546BaruStatus usulan:0817107401STMIK BUMI GORA083019Penelitian Dosen PemulaKode:I MADE PURWANTARA M.CsPENERAPAN METODE PROMETHEE DALAMPENILAIAN KINERJA DOSEN UNTUK PEMILIHAN DOSEN TELADAN2547BaruStatus usulan:0826078701STMIK BUMI GORA083019Penelitian Dosen PemulaKode:RAESUL AZHAR MTPerancangan Sistem Informasi Web-Base Pengolahan Nilai Akademik Siswa SMK Basis Kompetensi Dengan Fasilitas Layanan Informasi Media SMS Memanfaatkan Open Source Engine All Mobile Management Utilities2548BaruStatus usulan:0829087201STMIK BUMI GORA083019Penelitian Dosen PemulaKode:SURIYATIAnalisa dan Perancangan Pengolahan Nilai Raport secara Elektronik Berbasis Web dan SMS Gateway2549BaruStatus usulan:0818107101STMIK BUMI GORA083019Penelitian Dosen PemulaKode:NI GUSTI AYU DASRIANISegmentasi Citra Untuk Pengenalan Plat Nomor Kendaraan Indonesia2550BaruStatus usulan:0803027603STMIK BUMI GORA083019Penelitian Dosen PemulaKode:HUSAINENTERPRISE COMPUTING : MODEL INTEGRASI SISTEM INFORMASI LEWAT JARINGAN KOMPUTER ANTAR UNIT KERJA KOTA MATARAM2551BaruStatus usulan:0822028601STMIK BUMI GORA083019Penelitian Dosen PemulaKode:319

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- SEMLINDA JUSZANDRI BULAN S.KomAnalisis Faktor-Faktor yang Memengaruhi Knowledge Sharing di Antara Mahasiswa di Kupang Menggunakan Metode Partial Least Square2552BaruStatus usulan:0822117501SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:- PETRUS KATEMBA S.T., M.T.Rekayasa Perangkat Lunak Katalog Pesan Error Pada Bahasa Pemograman Visual Basic 20102553BaruStatus usulan:0801046901SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:MARLINDA VASTY OVERBEEKANALISIS ALTERNATIF KEBIJAKAN UNTUK MENGATASI KELANGKAAN BAHAN BAKAR MINYAK JENIS PREMIUM DI KOTA KUPANG DENGAN ANALYTICAL HIERARCHY PROCESS 2554BaruStatus usulan:0818038501SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:- FRANSISKUS MARIO HARTONO TJIPT S.KomPenentuan Rute Terpendek Untuk Wisata Kuliner di Kota Kupang Menggunakan Metode Forward Chaning2555BaruStatus usulan:0818038801SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:- JAMES ADAM SEO S.KomANALISIS PERUBAHAN PARARAMETER LEARNING PADA ALGORITMA BATCH TRAINING LEVENBERG-MARQUARDT(Studi Kasus Pada Perusahaan Kayu Lokal Kota Kupang-NTT) 2556BaruStatus usulan:0807067902SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:DONNA SETIAWATI S.Kom., M.MSTRATEGI INTEGRATED MARKETING COMMUNICATION PADA PROMOSI WISATA ROHANI PROSESI SAMANA SANTADI LARANTUKA2557BaruStatus usulan:0808057402SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:- MENLYA SNAE S.KomKEPUTUSAN PEMBELIAN LAPTOP DENGAN METODE FUZZY(Studi kasus Pada Mahasiswa Stikom Uyelindo Kupang)2558BaruStatus usulan:0825057901SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:- MARDHALIA SAITAKELA S.KomEVALUASI APLIKASI PEMASARAN DAN PENJUALAN BARANG DENGAN ANALISIS PIECES FRAMEWORK (Studi kasus Pada UD. Ratna Mulia Kupang)2559BaruStatus usulan:0826088301SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:320

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- TRI ANA SETYARINI S.Si., M.CsPREDIKSI HASIL TANGKAPAN IKAN DI NTT DENGAN FUZZY TIME SERIES2560BaruStatus usulan:0820057101SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:YOHANIS MALELAK S.Kom., M.CsSISTEM IDENTIFIKASI MOTIF TENUN ROTE DENGAN SEGMENTASI BERBASIS DISKONTINUITAS2561BaruStatus usulan:0810066501SEKOLAH TINGGI ILMU KOMPUTER UYELINDO083027Penelitian Dosen PemulaKode:GUSTI NGURAH ADITYA KRISNAWANThe Problems of Students in Using Past Tenses2562BaruStatus usulan:0830098701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I MADE DARMA SUSILAImplementasi Virtual Komputer Network Menggunakan Command Line Interface2563BaruStatus usulan:0830088405STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I NYOMAN KUSUMA WARDANA S.T., M.EngIdentifikasi Biometrik Intonasi Suara untuk Sistem Keamanan Berbasis Mikrokomputer2564BaruStatus usulan:0820098601STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI NYOMAN SUPUWININGSIHSistem Informasi Geografi Penyebaran Perguruan Tinggi Swasta di Pulau Bali dengan Menggunakan Bahasa Script Avenue2565BaruStatus usulan:0820128101STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I MADE RUDITANilai Dasar Pendidikan Karakter dalam Pertunjukan Wayang Kulit Cenk Blonk Lakon Kumbakarna Lina2566BaruStatus usulan:0830046601STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI LUH NYOMAN MIRAH WEDASARISISTEM INFORMASI TRACKING PENGAJUAN IJIN USAHA PADA DINAS PERIJINAN KOTA DENPASAR BERBASIS ANDROID2567BaruStatus usulan:0821088401STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:321

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADANIEL HADIPERANCANGAN SISTEM PENGELOMPOKAN KONSENTRASI MAHASISWA STUDI KASUS STMIK STIKOM BALI2568BaruStatus usulan:0827108201STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I GST AGUNG GEDE ARYA KADYANANPendeteksi Objek Berbasis Keyblock Framework2569BaruStatus usulan:0830018504STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I KOMANG SETIA BUANASistem Penghitungan Jumlah Kendaraan Dengan Teknik Pengolahan Citra Berbasis Java2570BaruStatus usulan:0829128501STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I GEDE PUTU WIRARAMA WEDASHWARAPLIKASI EMERGENCY CALL TRAFFIC INCIDENT BERBASIS ANDROID 2571BaruStatus usulan:0819098401STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI NYOMAN UTAMI JANUHARIKNOWLEDGE MANAGEMENT BAGI PENGEMBANGAN SISTEM INFORMASI PERPUSTAKAAN STIKOM BALI MENGGUNAKAN ZACHMAN FRAMWORK2572BaruStatus usulan:0825018301STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:SHOFWAN HANIEFVisualisai Image Reality Menggunakan Augmented Reality2573BaruStatus usulan:0827038101STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:ERMA SULISTYORINI SE.,MM.KomAnalisa Penerapan Sistem Penjaminan Mutu Bidang Akademik Berbasis ISO 9001:2008 IWA 2:2007(Studi Kasus di Sekolah Tinggi Manajemen Informatika dan Teknik Komputer, STMIK STIKOM Bali )2574BaruStatus usulan:0809037502STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:Ir IDA BAGUS PUTU WIDJA MTRancangan Kendali Tampilan Led Dot Matriks Dengan Sensor Infra Merah2575BaruStatus usulan:0814046902STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:322

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAI GUSTI AYU DESI SARYANTIRANCANG BANGUN APLIKASI STEGANOGRAFI PADA FILE BERTIPE IMAGE2576BaruStatus usulan:0813128701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:A A G AGUNG PUTRA RATU ASMARAPenerapan Customer Relationship Management Untuk Meningkatkan Kualitas Pelayanan Pada Perpustakaan 2577BaruStatus usulan:0813096601STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:LUH MADE YULYANTARI S.Kom.,M.PSPK PERENCANAAN KENAIKAN POSISI JABATAN PADA TINGKAT MANAJEMEN HOTEL DENGAN METODE PEMBOBOTAN DAN LOGIKA FUZZY2578BaruStatus usulan:0819078501STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:IGKG PURITAN WIJAYA ADHK-Means Clustering Dari News Feed Facebook Untuk Menentukan Kecenderungan Perubahan Keadaan Pemakai Media Sosial Facebook2579BaruStatus usulan:0812078402STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI KADEK ARIASIHMONITORING LOG SERVICE PADA SERVER BERBASIS WEB MENGGUNAKAAN PHPSHELL2580BaruStatus usulan:0812027801STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI WAYAN DERIANIPerbandingan Library OpenCV dengan EmguCV untuk Pendeteksian Multi Wajah2581BaruStatus usulan:0810088502STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I GST. NGR. DARMA PARAMARTHA ST.,MTPEMANFAATAN AUGMENTED REALITY PADA SISTEM INFORMASI GEOGRAFIS KAMPUS DI BALI2582BaruStatus usulan:0814048701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI KADEK DWI RUSJAYANTHI ST.,MTAplikasi Kalender Tenganan Pegringsingan Berbasis Web Menggunakan Framework Yii2583BaruStatus usulan:0809058502STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:323


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAI PUTU WARMA PUTRAIMPLEMENTASI METODE BEAUFORT CIPHER DAN BLOWFISH CIPHER UNTUK ENKRIPSI SMS PADA TELEPON SELULER BERBASIS ANDROID2592BaruStatus usulan:0801048701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI KADEK SUKERTIImplementasi Sistem Informasi Reservasi Speedboat Berbasis Web Service dan SMS Reply2593BaruStatus usulan:0810028203STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:INDRIANTOIMPLEMENTASI ENKRIPSI AES DAN RSA PADA PERANCANGAN APLIKASI E-MAIL CLIENT2594BaruStatus usulan:0815127901STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I GUSTI NGURAH AAN DARMAWANPemanfaatan JavaCV dalam Sistem Pengenalan Nomor Ganjil Genap pada Plat Kendaraan Roda Empat2595BaruStatus usulan:0818088501STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:DEDY PANJI AGUSTINOImplementasi .NET Framework Pada Sistem Informasi Maintenance Laboratorium STMIK STIKOM Bali2596BaruStatus usulan:0818058702STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:NI NYOMAN HARINI PUSPITASistem Informasi Tradisi Unik di Bali dengan Platform Mobile2597BaruStatus usulan:0817128601STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I WAYAN KARDANAGAMIFICATION PADA E-COMMERCE USAHA KECIL DAN MENENGAH (UKM) DI BALI2598BaruStatus usulan:0817078701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I GEDE SURYA RAHAYUDAModel Perencanaan Strategis Sistem dan Teknologi Informasi pada STMIK STIKOM Bali dengan Metode Ward dan Peppard 2599BaruStatus usulan:0817038701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:325

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANGGUN NUGROHOSISTEM INFORMASI GEOGRAFIS LOKASI HOTEL BERBASISKAN MOBILE DENGAN PENDEKATAN ZACHMAN FRAMEWORK2600BaruStatus usulan:0801126701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:BAGUS PRIBADISistem Cerdas Klasifikasi Jenis Kendaraan Melalui Teknik Olah Citra Digital dengan Java2601BaruStatus usulan:0815068101STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:I MADE ADI PURWANTARAMEMBANGUN APLIKASI SEARCH ENGINE KHUSUS WISATA2602BaruStatus usulan:0814108001STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:ROSALIA HADISISTEM INFORMASI GEOGRAFIS PENGELOLAAN DATA JALAN DI KOTA DENPASAR2603BaruStatus usulan:0814108701STIMIK - STIKOM BALI083030Penelitian Dosen PemulaKode:EFRON ERWIN YOHANIS LOEIDENTIFIKASI PEMBENTUKAN KATA DENGAN AFIKS DERIVASIONAL DALAM BAHASA TETUN2604BaruStatus usulan:0817027402SEKOLAH TINGGI BAHASA ASING MENTARI KUPANG083035Penelitian Dosen PemulaKode:NIKOLAUS BOLENG OLAKemampuan Penggunaan Bentuk-Bentuk Ungkapan Bahasa Inggris oleh Karyawan Hotel di Kota Kupang2605BaruStatus usulan:0826067201SEKOLAH TINGGI BAHASA ASING MENTARI KUPANG083035Penelitian Dosen PemulaKode:BUDI DARMAWANPERANCANGAN DAN PEMBUATAN ALAT PENGONTROL SUHU PASTEURISASI MEDIA TANAM JAMUR TIRAM BERBASIS MIKROKONTROLER ATMEGA 162606BaruStatus usulan:0826058503STMIK LOMBOK083041Penelitian Dosen PemulaKode:Dra E C ENDANG KARTINI M.AkBalanced Scorecard Sebagai Tolak Ukur Penilaian Kinerja Pada Organisasi Pemerintah (Studi Kasus pada Rumah Sakit Umum Kota Mataram)2607BaruStatus usulan:0823046201SEKOLAH TINGGI ILMU EKONOMI AMM083043Penelitian Dosen PemulaKode:326

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAUSMANKEBIJAKAN RELOKASI DAN RENOVASI PEDAGANG KAKI LIMA DAN IMPLIKASINYA BAGI PENDAPATAN MASYARAKAT DAN PENDAPATAN ASLI DAERAH KOTA MATARAM2608BaruStatus usulan:0830066201SEKOLAH TINGGI ILMU EKONOMI AMM083043Penelitian Dosen PemulaKode:- NIZAR HAMDI M.M.IMPLEMENTASI DAN EFEKTIVITAS PROGRAM PINJAMAN BERGULIRPROGRAM NASIONAL PEMBERDAYAAN MASYARAKATMANDIRI PERKOTAAN ( PNPM MP )DI KOTA MATARAM2609BaruStatus usulan:0805016901SEKOLAH TINGGI ILMU EKONOMI AMM083043Penelitian Dosen PemulaKode:ZULKARNAENKEBERPIHAKAN PROGRAM BUMI SEJUTA SAPI (BSS) PEMERINTAH PROVINSI NUSA TENGGARA BARAT TERHADAP PETERNAK SAPI 2610BaruStatus usulan:0802047101SEKOLAH TINGGI ILMU EKONOMI AMM083043Penelitian Dosen PemulaKode:Dra. BAIQ KISNAWATI M.AkPengukuran Kinerja Pada Organisasi Sektor Publik Dipandang Dari Perspektif Kepuasan Pelanggan (Studi Kasus Pada Puskesmas Kecamatan Gunungsari)2611BaruStatus usulan:0817066301SEKOLAH TINGGI ILMU EKONOMI AMM083043Penelitian Dosen PemulaKode:NURMAWATYHubungan Faktor Lingkungan Fisik Rumah dengan Kejadian Pneumonia pada Balita 2612BaruStatus usulan:0825015401SEKOLAH TINGGI TEKNIK LINGKUNGAN MATARAM083045Penelitian Dosen PemulaKode:I PUTU PUTRA ASTAWA S.Kom.,M.KomIDENTIFIKASI SEL KANKER PROSTAT BERBASIS OPERASI MORPOLOGI2613BaruStatus usulan:0825107701STMIK DENPASAR083046Penelitian Dosen PemulaKode:SABIAH KHAIRIDETERMINAN FAKTOR YANG MEMPENGARUHI PENGAMBILAN KEPUTUSAN PEMENUHAN KEBUTUHAN NUTRISIIBU HAMIL ANEMIA2614BaruStatus usulan:0822068402STIKES YARSI MATARAM083047Penelitian Dosen PemulaKode:HERI BAHTIARHubungan Tingkat Kepatuhan Pelaksanaan Protap Perawatan Luka Post Sectio Caesarea dengan Kejadian Infeksi Luka Post Sectio Caesarea di Ruang Melati RSUP NTB2615BaruStatus usulan:0830107601STIKES YARSI MATARAM083047Penelitian Dosen PemulaKode:327

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANIEK SURYANTI KUSUMA S.Kom., M.KomDESAIN DAN IMPLEMENTASI SISTEM MONITORING RUANGAN DI STMIK STIKOM INDONESIA2616BaruStatus usulan:0823088003STIKOM Indonesia083056Penelitian Dosen PemulaKode:I PUTU GEDE BUDAYASAOptimasi Penjadwalan Seminar dan Sidang Tugas Akhir Pada Sistem Informasi Tugas Akhir di STMIK STIKOM Indonesia2617BaruStatus usulan:0820068402STIKOM Indonesia083056Penelitian Dosen PemulaKode:ANAK AGUNG GEDE BAGUS ARIANARANCANG BANGUN MEDIA PEMBELAJARAN ALAT MUSIK GAMELAN GONG KEBYAR BERBASIS ANDROID2618BaruStatus usulan:0815038602STIKOM Indonesia083056Penelitian Dosen PemulaKode:I MADE MARTHANA YUSAPengembangan Aplikasi Cerita Rakyat Bali untuk Mengajarkan Kearifan Lokal bagi Anak Sekolah Dasar Berbasis Mobile2619BaruStatus usulan:0831038302STIKOM Indonesia083056Penelitian Dosen PemulaKode:DWI PUTRA GITHARANCANG BANGUN SISTEM PENCATATAN PORTOFOLIO UNTUK EVALUASI KINERJA DOSEN PADA STMIK STIKOM INDONESIA2620BaruStatus usulan:0806068602STIKOM Indonesia083056Penelitian Dosen PemulaKode:I WAYAN SUDIARSAperancangan aplikasi sosialisasi pemilihan dan pemungutan suara pemilu legislatif 2014 berbasis teknologi android pada komisi pemilihan umum provinsi bali2621BaruStatus usulan:0812028003STIKOM Indonesia083056Penelitian Dosen PemulaKode:I KADEK DWI GANDIKA SUPARTHARANCANG BANGUN SISTEM INFORMASI PERSEDIAAN DAN PEMINJAMAN INVENTORI DI STMIK STIKOM INDONESIA2622BaruStatus usulan:0823118501STIKOM Indonesia083056Penelitian Dosen PemulaKode:I DEWA MADE ADI BASKARA JONISISTEM PENDUKUNG KEPUTUSAN SELEKSI PENERIMAAN DOSEN TETAP YAYASAN DENGAN METODE FUZZY-AHP PADA STMIK STIKOM INDONESIA2623BaruStatus usulan:0810088702STIKOM Indonesia083056Penelitian Dosen PemulaKode:328

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAI MADE BAYU WISNAWA A.Par., M.M., M.Par.PENGEMBANGAN POTENSI WISATA PANTAI KEDUNGU MENJADI PRODUK WISATA KREATIF DI KABUPATEN TABANAN BALI2624BaruStatus usulan:0006127503Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:I MADE WARDHANAStrategi Pengembangan Objek Wisata Danau Beratan Tabanan Bali2625BaruStatus usulan:0021125404Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:PUTU AGUS PRAYOGI SST.Par., M.Par.PENGEMBANGAN RUMAH TRADISIONAL SEBAGAI SARANA AKOMODASI DI DESA BAYUNG GEDE, KABUPATEN BANGLI2626BaruStatus usulan:0002068201Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:PUTU DIAH KESUMA DEWIFaktor - faktor yang menjadi pertimbangan masyarakat memilih pasar tradisional di Denpasar2627BaruStatus usulan:0813088303Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:L K HERINDIYAH KARTIKA YUNI S.S.T., Par., Dampak Pengembangan Objek wisata di Desa Taro terhadap pendapatan masyarakat di Desa Taro kebupaten Gianyar Bali.2628BaruStatus usulan:0822067601Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:I GUSTI AGUNG BAGUS WIDIANTARASTRATEGI PENGEMBANGAN POTENSI ECO-LODGE SEBAGAI DAYA TARIK WISATA DI DESA SIDEMEN KABUPATEN KARANGASEM, BALI2629BaruStatus usulan:0830107701Sekolah Tinggi Pariwisata Triatma Jaya083058Penelitian Dosen PemulaKode:I DEWA AYU RISMAYANTIPENINGKATAN PERAN SERTA DESA ADAT DALAM PENANGGULANGAN HIV DI KAWASAN WISATA LOVINA KABUPATEN BULELENG – BALI2630BaruStatus usulan:0820078701Sekolah Tinggi Ilmu Kesehatan Majapahit Singaraja083060Penelitian Dosen PemulaKode:KADEK YUDI ARYAWANPENGEMBANGAN MEDIA PEMBELAJARAN INTERAKTIFBERMUATAN CONCEPTUAL CHANGE UNTUKPERKULIAHAN KEPERAWATAN HIV/AIDS DI STIKES MAJAPAHIT SINGARAJA2631BaruStatus usulan:0810078703Sekolah Tinggi Ilmu Kesehatan Majapahit Singaraja083060Penelitian Dosen PemulaKode:329



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWILDHAN BURHANUDDIN S.PdINVESTIGATING THE FUNCTIONS OF DISCOURSE MARKERS IN EFL CLASSROOM INTERACTION2648BaruStatus usulan:0926048802UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:ISMAIL SANGKALA S.PdWriting Recount Paragraph through Flexible Grouping Strategy for EFL Students in English Education Department of Makassar Muhammadiyah University2649BaruStatus usulan:0921018703UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:Ir. ANDI KHAERIYAH M.Pd optimasi pemanfaatan tepung cacing tanah Lumbricus sp sebagai bahan baku pakan alternatif untuk meningkatkan pertumbuhan dan sintasan benih ikan kerapu tikus pada tahap pendederan2650BaruStatus usulan:0926036803UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:SITTI ASNAENI S.SosPerubahan Prilaku Sosial-Budaya (Studi pada masyarakat penerima Bantuan Langsung Tunai di Kelurahan Batangkaluku Kabupaten Gowa)2651BaruStatus usulan:0917057801UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:ABDAN SYAKUR S.Pd., M.PdPENERAPAN METODE COURSE REVIEW HORAY DALAM MENINGKATKAN KETERAMPILAN BERBICARA SISWA KELAS VII SMP GUPPI SAMATA2652BaruStatus usulan:0921018202UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:A HUSNIATI S.Pd., M.Pd.PEMBELAJARAN MATEMATIKA MELALUI PENERAPAN MODEL KOOPERATIF TIPE THINK PAIR SHARE (TPS) PADA MAHASISWA SEMESTER LIMA MATA KULIAH KALKULUS SATU2653BaruStatus usulan:0904058002UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:MUTMAINNAH S.PdPROSES BERPIKIR MAHASISWA DALAM MENYELESAIKAN MASALAH MATEMATIKA TERBUKA DITINJAU DARI PERBEDAAN KEMAMPUAN MATEMATIKA (Studi Kasus Mahasiswa S1 PGSD FKIP Universitas Muhammadiyah Makassar)2654BaruStatus usulan:0912018502UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:MA RUP S.Pd.,M.PdEksplorasi Perkuliahan Program Linear Berbasis Budaya Bugis-Makassar Pada Mahasiswa Program Studi Pendidikan Matematika 2655BaruStatus usulan:0908048502UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:332

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAREZKAWATI SAAD S.SiANALISIS EFEKTIFITAS PEMANFAATAN TEKNOLOGI INFORMASI BERBASIS E-LEARNING DALAM PEMBELAJARAN FISIKA PADA PESERTA DIDIKSMA MUHAMMADIYAH LIMBUNG2656BaruStatus usulan:0925128505UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:MAHMUDDIN S.T., M.TAnalisis Spasial Tingkat Rawan Erosi Daerah Hulu DAS Biangloe Kabupaten Bantaeng2657BaruStatus usulan:0917126801UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:ILHAMSYAH S.PdPenerapan Metode Mind Power (Kekuatan Pikiran) Pada Siswa Kelas XI SMA Negeri 1 Parigi Kabupaten Gowa.2658BaruStatus usulan:0926068601UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:ANDI ADAM S.Pd., M.Pd.PENERAPAN PENDEKATAN PROSES DALAM MENINGKATKAN KEMAMPUAN MENGAPRESIASI PUISI PADA MURID KELAS V SD PERTIWI MAKASSAR2659BaruStatus usulan:0918087802UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:NENNY S.T., M.TPENGARUH KECEPATAN ALIRAN TERHADAP GERUSAN LOKAL DISEKITAR PILAR HEKSAGONAL(UJI MODEL LABORATORIUM)2660BaruStatus usulan:0916036801UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:NURDEVI BTE ABDUL S.PdTHE USE OF AUDIO-LINGUAL METHOD IN TEACHING LISTENING COMPREHENSION AT THE SECOND YEAR STUDENTS OF SMK YAPIP MAKASSAR SUNGGUMINASA(A Classroom Action Research)2661BaruStatus usulan:0910048402UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:ISMAIL RASULONG S.E.Pengaruh Dana Perimbangan dan Pertumbuhan Ekonomi Terhadap Pendapatan Asli Daerah Kabupaten Takalar2662BaruStatus usulan:0905107302UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:JAMALUDDIN ARIFIN S.PdEfektifitas Penggunaan Media Pembelajaran dalam Meningkatkan Hasil dan Motivasi Belajar Siswa pada Mata Pelajaran Sosiologi di SMA Negeri 1 Sinjai Utara2663BaruStatus usulan:0919088301UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:333

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAERNAWATI S.PdPENGARUH EFIKASI DIRI, KONSEP DIRI DAN KEMANDIRIAN BELAJAR TERHADAP PRESTASI BELAJAR MATEMATIKA PADA SISWA SMP PESANTREN PUTRI YATAMA MANDIRI KAB. GOWA2664BaruStatus usulan:0911108702UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:BURHANUDDIN S.Pi.,M.PAplikasi Pemanfaatan Arang dalam Media Kultur terhadap Pertumbuhan Rotifera branchionus plicatilis2665BaruStatus usulan:0912066901UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:IRMAWANTY S.Si., M.SiPenerapan Model Pembelajaran Kooperatif Tipe Group Investigation untuk Meningkatkan Kualitas Pembelajaran IPA Murid Kelas IV SDN 71 Rappojawa Makassar2666BaruStatus usulan:0906057302UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:UMMI KHAERATI SYAM S.Pd., M.PdInformation Transfer Technique in Teaching Writing 2667BaruStatus usulan:0923088201UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:JUMIATI S.P.,M.MAnalisis Nilai Tambah Diversifikasi Produk Olahan Ubi Jalar Ungu di Kabupaten Takalar2668BaruStatus usulan:0912087504UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:MUH. ARIEF MUHSIN S.PdKETERGABUNGAN PENDIDIKAN KARAKTER DAN POSITIVE FEEDBACK DALAM PEMBELAJARAN BAHASA INGGRIS DI SEKOLAH ISLAM ATHIRAH MAKASSAR2669BaruStatus usulan:0902078303UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:SYEKH ADIWIJAYA LATIF S.Pd., M.PdPENINGKATAN KEMAMPUAN MENYIMAK MELALUI METODE BISIK BERANTAI SISWA KELAS VIII SMP MUHAMMADIYAH UNISMUH MAKASSAR2670BaruStatus usulan:0910038101UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:HAERUL SYAM S.Pd., M.PdPenerapan Pendekatan Open-Ended Untuk Meningkatkan Hasil Belajar Matematika pada Materi Bangun Datar pada Murid Kelas V SD Inpres Bontoala 1 Kecematan Pallangga Kabupaten Gowa2671BaruStatus usulan:0923018001UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:334

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAISKANDAR S.Pd.,M.PdNeologisme Bahasa Prokem Dalam Kegiatan Kreativitas Remaja (Keker) Surat Kabar Harian Fajar2672BaruStatus usulan:0910117701UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:SALAM S.E.AkMODEL ELECTRONIC BUSINESS B2B : TINJAUAN TEORITIS BERDASARKAN PROSES DAN ANALISIS MODEL B2B2673BaruStatus usulan:0931126607UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:SITTI FITHRIANI SALEH S.Pd., M.PdMENINGKATKAN HASIL BELAJAR MATEMATIKA MAHASISWA PRODI PGSD FKIP UNISMUH MAKASSAR MELALUI PENERAPAN PEMBELAJARAN APTITUDE TREATMENT INTERACTION (ATI)2674BaruStatus usulan:0914047901UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:JUNAID S.PdImproving The Students’ Pronunciation In Speaking through Prosody Pyramid at the Second Semester of English Education Department Makassar Muhammadiyah University2675BaruStatus usulan:0902058104UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:AMRULLAH M. S.T.,M.T“Kajian Prediksi Tingkat Bahaya Erosi (TBE) pada Pemanfaatan Lahan Berbagai Jenis Tanaman Sub DAS Mataallo Kab. Enrekang Prov. Sulawesi Selatan"2676BaruStatus usulan:0913106902UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:HUSNAH LATIFAH S.Hut.,M.SiPengembangan Pemanfaatan Minyak Jelantah dalam Perbaikan Kualitas Kayu Dari Hutan Rakyat Dengan Menggunakan Metode Oil Tempering2677BaruStatus usulan:0909067302UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:Ir. ARIFIN FATTAH M.SiSTRATEGI PEMENUHAN PANGAN POKOK KELUARGA PETANI DENGAN POTENSI PANGAN LOKAL DI KECAMATAN BONTONOMPO KABUPATEN GOWA2678BaruStatus usulan:0915056401UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:Dra. HASNAWATI M.PdIMPROVING THE STUDENTS’ SPEAKING SKILL BY USING TASK-BASED APPROACH TO AT THE SECOND YEAR STUDENTS OF SMA NEGERI 2 SUNGGUMINASA KAB. GOWA2679BaruStatus usulan:0915066303UNIVERSITAS MUHAMMADIYAH MAKASAR091004Penelitian Dosen PemulaKode:335


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASAMUEL STANLY HADJOAN EXAMINATION AND IMPROVEMENT ON THE ROLE OF NURSES IN COMMUNITY HEALTH PROMOTION2688BaruStatus usulan:0922117904UNIVERSITAS KLABAT091007Penelitian Dosen PemulaKode:MARKY S SUMAMPOWEVALUASI PERKECAMBAHAN BENIH DAN PERTUMBUHAN BIBIT KELAPA HASIL PERSILANGAN KELAPA GENJAH SALAK DENGAN KELAPA DALAM MAPANGET (GSK x DMT)2689BaruStatus usulan:0912127304UNIVERSITAS KLABAT091007Penelitian Dosen PemulaKode:IKA PRAYANTHI MMFAKTOR-FAKTOR YANG MEMPENGARUHI PENGUNGKAPAN TANGGUNG JAWAB SOSIAL DAN DAMPAKNYA PADA KINERJA KEUANGAN PADA PERUSAHAAN YANG TERDAFTAR DI BURSA EFEK INDONESIA PERIODE 2007-20112690BaruStatus usulan:0925068604UNIVERSITAS KLABAT091007Penelitian Dosen PemulaKode:ADI CHANDRA SYARIF M.Sc.Pengembangan Aplikasi Penjadwalan Mata Kuliah untuk Universitas Atma Jaya Makassar dengan Pendekatan Perampingan Algoritma Evolusi dan Pendistribusian Beban2691BaruStatus usulan:0901127202UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:STEFANY YUNITA BARALANGI S.Si.,M.T.Implementasi Protokol Modbus TCP Pada Sistem Monitoring Besaran Listrik Menggunakan LabView dan Power Meter Schneider 8102692BaruStatus usulan:0927068301UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:SEAN COONERY SUMARTA S.T.KOMPUTASI PARALEL ALGORITMA GENETIKA PADA TRAVELING SALESMAN PROBLEM DENGAN COMPUTE UNIFIELD DEVICE ARCHITECTURE (CUDA)2693BaruStatus usulan:0907058203UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:INONG S.T.Test Fatique Pervius Pavement Aspal Dengan Menggunakan Batu Pantai (Quarsite Dolomite)2694BaruStatus usulan:0918027904UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:PHIE CHYAN S.T, MCsSistem Temu Balik Citra Menggunakan Ekstraksi Fitur Citra Dengan Klasifikasi Region Untuk Identifikasi Objek2695BaruStatus usulan:0913048102UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:337

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWIHALMINUS SOMBOLAYUK S.E., M.SiUPAYA PENINGKATAN KINERJA KEUANGAN LEWAT PEMBELAJARAN ORGANISASI – STUDI PADA UKM DALAM KOTA MADYA MAKASSAR2696BaruStatus usulan:0923086602UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:WENCISLAUS SIRJON NANSIStudi Efektivitas Penerapan Aturan Hukum Reklamasi Pantai Losari Terhadap Penanggulangan Dampak Lingkungan Dan Sosial Masyarakat Pesisir Kota Makassar2697BaruStatus usulan:0905048202UNIVERSITAS ATMA JAYA MAKASSAR091009Penelitian Dosen PemulaKode:Drs. SAIMAN SUTANTO M.Si.Pengaruh Penambahan CMC (Carboksimetilselulosa) dan Gula dalam Pembuatan Sirup Strawberry 2698BaruStatus usulan:0018046604UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:IKSAN RAUFFaktor-factor yang mempengaruhi penerapan e-government dalam diseminasi program pembangunan Pemerintah Kota Makassar2699BaruStatus usulan:0907057002UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:SUTIA BUDI S.Pi., M.SiPengaruh Ekstrak Buah Pala Myristica Argentha Terhadap Pigmentasi, Pertumbuhan dan Sintasan Ikan Koi Cyprinus carpio Dengan Dosis Yang Berbeda2700BaruStatus usulan:0927067601UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:HERLINA FAHARUDDINPengaruh Substitusi ampas tahu dengan konsentrat dalam pakan ayam broiler 2701BaruStatus usulan:0916087303UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:MUHAMMAD AWALUDDIN HAMDY S.T., M.Si.Eksistensi Permukiman Rumah Tradisional - Vernakular Bugis Makassar di Kawasan Pesisir Kota Makassar Dalam Penerapan Konsep Mitigasi Bencana2702BaruStatus usulan:0907087004UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:IR TAMRIN MALLAWANGENG MTANALISIS KINERJA PELAYANAN ANGKUTAN UMUM DI MAKASSAR SULAWESI SELATAN2703BaruStatus usulan:0907116602UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:338

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUHAMMAD SAMIR A S.E., M.Si.PENGARUH INTERNAL SERVICE QUALITY TERHADAP RETENSI KARYAWAN PADA BANK SYARIAH MANDIRI2704BaruStatus usulan:0915017801UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:ARMAN SETIAWAN S.T, M.T.ANALISIS GERAK HEAVING PADA STRUKTUR MONOHULL2705BaruStatus usulan:0908127803UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:MINARNI S.Psi., M.A.Konsep Diri Uwatta dan Uwa (Studi Pada Komunitas Towani Tolotang Di Kab.Sidrap)2706BaruStatus usulan:0910078104UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:ANDI TIRA SH., M.HKinerja Hukum Pidana Lingkungan Terhadap Perilaku Pencurian Biota Laut Di Perairan Polewali Mandar2707BaruStatus usulan:0920086701UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:HERNINAWATY ABUBAKAR SE., M.M.PENGARUH FINANSIAL LEVERAGE DAN OPERATING LEVERAGE TERHADAP RENTABILITAS PERUSAHAAN PADA PT. PANCONIN CIPTA PERKASA DI MAKASSAR2708BaruStatus usulan:0924126801UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:ZULKHAIR BURHAN S.Ip.,MA.ANALISIS KEBIJAKAN PEMERINTAH PROVINSI SULAWESI SELATAN DALAM PROGRAM LUMBUNG PANGAN ASEAN BIMP-EAGA (Brunei Darussalam-Indonesia-Malaysia-Philippines East ASEAN Growth Area)2709BaruStatus usulan:0903048101UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:FARIDAH SE., M.Si., AkImplementasi Penerapan CSR dalam Keberlanjutan Usaha Pada PT Semen Bosowa di Makassar2710BaruStatus usulan:0904047002UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:SOBIRIN S.S.THE STUDENTS’ ABILITY IN USING PREPOSITION AT SMA NAHDIYAT MAKASSAR2711BaruStatus usulan:0902127203UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:339

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYASNIPENGARUH SHOPPING LIFE STYLE DAN FASHION INVOLMENT TERHADAP IMPULSE BUYING BEHEVOR MASYARAKAT HIGH INCOME MAKASSAR2712BaruStatus usulan:0904056802UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:ACHMADY MAnalisis Aktivitas Corporate Social Responsibilty (CSR) Pada PT. BankNegara Indonesia (Persero) TBK. Cabang Syariah Makassar.2713BaruStatus usulan:0904086701UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:RAFIUDDIN SEAnalisis Perilaku Wirausaha Terhadap Keberlanjutan Pada Kawasan Agropolitan di Kabupaten Enrekang2714BaruStatus usulan:0931125705UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:BASRI SH., M.HPerlindungan Hukum Terhadap Pelaku Usaha Industri Barang Dan Jasa Dalam Perspektif Hukum Hak Kekayaan Intelektual Di Makassar 2715BaruStatus usulan:0927076501UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:AGUS PURNOMO SEAnalisis Karakteristik & Perilaku Wirausaha Pedagang Pasar Pagi Pada Kawasan Pantai Losari Makassar2716BaruStatus usulan:0902097502UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:KAMSILANIAH SH., M.HAnalisis Aspek Hak Kekayaan Intelektual dalam Pembuatan Sarung sutera Mandar2717BaruStatus usulan:0924116401UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:HERMIATYAlokasi waktu kerja dan kontribusi perempuan terhadap pendapatan keluarga2718BaruStatus usulan:0920066403UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:DAMRA HUSAINPenerapan Higiene Personal pada Pedagang Bakso di Pantai Losari Makassar2719BaruStatus usulan:0905076603UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:340

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAINDRAYANI NUR S.Pd., M.SiAnalisis Strategi Sales Marketing Departement Terhadap Peningkatan Penjualan Seng Pada PT Sermani Steel di Makassar2720BaruStatus usulan:0905097702UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:Dra. ANDI HAMSIAH M.PdPeningkatan Kreativitas Menulis Puisi pada Siswa Kelas VII-1 SMP Buqatum Mubarakah Pondok Pesantren Darul Aman Makassar dengan Menggunakan Teknik Pengelompokan Kata (clustering).2721BaruStatus usulan:0905086901UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:SERI SURIANI S.E., M.Si.Pengaruh Penerapan Anggaran Berbasis Kinerja Terhadap Akuntabilitas Kinerja Instansi Pemerintah Kabupaten Wajo2722BaruStatus usulan:0927097001UNIVERSITAS 45 MAKASSAR091010Penelitian Dosen PemulaKode:MAISAH S.H.,M.H.TINDAK PIDANA KRIMINALITAS TERHADAP PELAKU PERKELAHIAN KELOMPOK ANTARWARGA DI KOTA PALU2723BaruStatus usulan:0902076702UNIVERSITAS MUHAMMADIYAH PALU091011Penelitian Dosen PemulaKode:ABDUR RAUF S.Hut., MPPRODUKSI SERASAH JENIS MANGROVE SEBAGAI SUMBER NUTRIEN PERAIRAN PANTAI DI TANJUNG MALAKOSA 2724BaruStatus usulan:0909127701UNIVERSITAS MUHAMMADIYAH PALU091011Penelitian Dosen PemulaKode:IRMAWATY S.H.,M.HPENANGGULANGAN DELIK PERKOSAAN DI LINGKUNGAN KELUARGA ( Studi Kasus di Wilayah Kota Palu )2725BaruStatus usulan:0902027001UNIVERSITAS MUHAMMADIYAH PALU091011Penelitian Dosen PemulaKode:ANDI IRWAN S.Sos, MPATransparansi dan Akuntabilitas Pelayanan PenerbitanSurat Tanda Nomor Kendaraan (STNK) dan SuratKetetapan Pajak Kendaraan Bermotor di Kantor SistemAdministrasi Manunggal di Bawah Satu Atap(SAMSAT) Kota PaIu Ptovinsi Sulawesi Tengah2726BaruStatus usulan:0931128004UNIVERSITAS MUHAMMADIYAH PALU091011Penelitian Dosen PemulaKode:- SUDIRMAN SKM, M.KesANALISI FAKTOR YANG BERHUBUNGAN DENGAN TERJADINYAPLEBITIS PADA TINDAKAN PROSEDURAL PEMASANGAN INFUSDI RUMAH SAKIT KOTA PALUTAHUN 20142727BaruStatus usulan:0911038301UNIVERSITAS MUHAMMADIYAH PALU091011Penelitian Dosen PemulaKode:341


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYULINDA TANARI S.P.,M.SiPengendalian Getah Kuning Manggis melalui Pengaturan Dosis Sumber Kalsium2736BaruStatus usulan:0923107901UNIVERSITAS SINTUW U MAROSO POSO091012Penelitian Dosen PemulaKode:KAMELIA DWI JAYANTI S.SiPEMBANGKITAN DATA CURAH HUJAN DAN ANALISIS NERACA AIR UNTUK MENENTUKAN MASA TANAM PADI SAWAH TADAH HUJAN DI DESA SILANCA, KECAMATAN LAGE, KABUPATEN POSO, SULAWESI TENGAH2737BaruStatus usulan:0902018602UNIVERSITAS SINTUW U MAROSO POSO091012Penelitian Dosen PemulaKode:ENDANG SRI DEWI HS. SP.,M.ScKajian Peningkatan Serapan NPK pada Pertumbuhan Dan Hasil Tanaman Jagung Dengan Pemberian Kombinasi Pupuk anorganik Majemuk dan berbagai Pupuk Organik2738BaruStatus usulan:0927058305UNIVERSITAS SINTUW U MAROSO POSO091012Penelitian Dosen PemulaKode:GITIT INDRA PUTRA WACANA S.S.,M.HumPeningkatan Kemampuan Berbicara Siswa Melalui Pendekatan Pembelajaran Bahasa Komunikatif2739BaruStatus usulan:0914068301UNIVERSITAS SINTUW U MAROSO POSO091012Penelitian Dosen PemulaKode:ANDRI AMALIEL MANAGANTA SP.,M.SiSTUDI HABITAT DAN IVENTARISASI ANGGREK HITAM (Black Orchid) DI KAWASAN HUTAN CAGAR ALAM BANCEA KECAMATAN PAMONA SELATAN KABUPATEN POSO2740BaruStatus usulan:0912068401UNIVERSITAS SINTUW U MAROSO POSO091012Penelitian Dosen PemulaKode:Dr. AHDAN S S.Sos., M.Si.OPTIMALISASI SEKTOR PENDAPATAN NELAYAN MELALUI PENGEMBANGAN TEKNOLOGI PASCA PANEN DAN PRODUKSI BENIH MARIKULTUR DI PESISIR PANTAI SULAWESI BARAT2741BaruStatus usulan:0005116603UNIVERSITAS SAWERIGADING MAKASSAR091013MP3EIKode:Drs. MUHAMMAD YAHYA M.SiMODEL STRATEGI PENGEMBANGAN KECAMATAN DALAM MENDUKUNG PENINGKATAN EKONOMI MASYARAKAT DI KABUPATEN MAROS2742BaruStatus usulan:1205106501UNIVERSITAS SAWERIGADING MAKASSAR091013Penelitian Dosen PemulaKode:ANITA CANDRA DEWIPenerapan Model Peta pikiran (Mind Mapping) dalam Meningkatkan Pembelajaran Menulis Puisi Siswa Kelas VII SMPN 2 Tanete Rilau Kabupaten Barru2743BaruStatus usulan:0901018501UNIVERSITAS SAWERIGADING MAKASSAR091013Penelitian Dosen PemulaKode:343



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEDI TADUNG S.SOSKINERJA APARAT DALAM PENYELENGGARAAN PEMERINTAHAN(STUDI PADA SEKRETARIAT PEMERINTAH DAERAH KABUPATEN KONAWE)2760BaruStatus usulan:0910048003UNIVERSITAS LAKIDENDE UNAHAA091021Penelitian Dosen PemulaKode:ANDI NUDDINModel Alternatif Kelembagaan Produksi Kakao sebagai Percepatan Pembangunan Ekonomi Indonesia untuk Mereduksi Kemiskinan dan Antisipasi Menghadapi Asean Economic Community2761BaruStatus usulan:0027075615UNIVERSITAS MUHAMMADIYAH PARE-PARE091024MP3EIKode:USMANPengembangan Sistem Edukasi Pencegahan Penyakit Malaria Berbasis Development of Civil Sosiety di Kota Parepare2762BaruStatus usulan:0927078602UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:- ARHAM S.E.Analisis Efisiensi Keuangan Rumah Sakit Umum Daerah (RSUD) Andi Makkasau Pemerintah Daerah Kota Parepare 2763BaruStatus usulan:0902108301UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:- HENNI KUMALADEWI HENGKY S.KM.,M.Kes.PENERAPAN PERENCANAAN PENANGGULANGAN FILARIASIS DI KABUPATEN SIDENRENG RAPPANG2764BaruStatus usulan:0922078301UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:KARTINI NAPIRAH S.P. M.SiKajian Agribisnis Kubis Di Desa Wayame Kecamatan Teluk Ambon Kota Ambon2765BaruStatus usulan:0903038502UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:- KHADIJAH MAMING S.Pd. M.Pd.THE EFFECT OF COMPREHENDING THE MAIN IDEA OF SHORT TEXTS IN MOTIVATING THE ENGLISH DEPARTMENT STUDENTS OF FKIP UMPAR BECOMING AN ACTIVE READER2766BaruStatus usulan:0931038602UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:- HAMSYAH S.T.Analisis Elastisitas Balok Baja Kantilever Akibat Beban Siklik2767BaruStatus usulan:0912087702UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:346

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHJ. SALASIAHAplikasi Mind Visualizer dalam Pengembangan Kemampuan Berbahasa Inggris pada Mata Kuliah Speaking2768BaruStatus usulan:0907027602UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:NURHAEDAFORMULASI MIKROBA Aspergillus niger DENGAN MENGGUNAKAN BERBAGAI JENIS MEDIA TUMBUH DARI BAHAN ORGANIK2769BaruStatus usulan:0925077603UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:SAHABUDDINAnalisis Morfometrik dan Meristik Rabbitfish (Siganus Sp) di Perairan Spermonde dan Teluk Bone2770BaruStatus usulan:0906068204UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:RAHMI AMIR S.Si., M.KesIDENTIFIKASI FAKTOR KONDISI SANITASI SARANA AIR BERSIH SUMUR GALI TERHADAP KEJADIAN PENYAKIT DIARE DI WILAYAH KERJA PUSKESMAS MADISING NA MARIO KOTA PAREPARE2771BaruStatus usulan:0911107701UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:- SYAWAL S.Pd., M.Pd.Metode TOP dalam Pengajaran Speaking2772BaruStatus usulan:0926068501UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:MAKHRAJANI MAJIDPengembangan Metode Penyuluhan Pencegahan Kematian Neonatal Dini Di Kota Parepare2773BaruStatus usulan:0910118601UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:HANIARTI S.Si., APT., M.Kes.Pengembangan Sistem Edukasi Manajemen Laktasi pada Ibu Hamil di Kota Parepare2774BaruStatus usulan:0929046901UNIVERSITAS MUHAMMADIYAH PARE-PARE091024Penelitian Dosen PemulaKode:ISMAWATI DOEMBANAPENGARUH EFEKTIVITAS KOMUNIKASI INTERPERSONAL GURU TERHADAP TINGKAT PRESTASI BELAJAR SISWA SEKOLAH MENENGAH PERTAMA (SMP) NEGERI 5 LUWUK KECAMATAN LUWUK UTARA KABUPATEN BANGGAI2775BaruStatus usulan:0911118402UNIVERSITAS MUHAMMADIYAH LUWUK BANGGAI091025Penelitian Dosen PemulaKode:347

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASISWADI SULULINGPENGARUH LIKUIDITAS DAN PROFITABILITASTERHADAP RETURN SAHAM PADA PERUSAHAAN MAKANAN DAN MINUMANDI BURSA EFEK INDONESIA PERIODE 2009-20112776BaruStatus usulan:0922077101UNIVERSITAS MUHAMMADIYAH LUWUK BANGGAI091025Penelitian Dosen PemulaKode:TASRUDDINPERBANDINGAN ASPEK EKOLOGI DAN KARAKTERISTIK BULUBABI, Tripneustes gratilla PADA ZONA BERBEDA UNTUK RESTOCKING DAN APLIKASI AQUAKULTUR BERKELANJUTAN2777BaruStatus usulan:0914076801UNIVERSITAS MUHAMMADIYAH LUWUK BANGGAI091025Penelitian Dosen PemulaKode:MARLANAnalisis Prevalensi Parasit Yang Menginfeksi Benih Ikan Nila (Oreochromis Niloticus) Pada Sentra Pembenihan Di Wilayah Kabupaten Banggai2778BaruStatus usulan:0914017901UNIVERSITAS MUHAMMADIYAH LUWUK BANGGAI091025Penelitian Dosen PemulaKode:Ir. SRI SUKARI AGUSTINA M.Si.IDENTIFIKASI TINGKAT SERANGAN BAKTERI YANG MENGINFEKSI KOMODITI RUMPUT LAUT DI PERAIRAN TELUK TOLO DAN TELUK TOMINI KABUPATEN BANGGAI SULAWESI TENGAH2779BaruStatus usulan:0919086501UNIVERSITAS MUHAMMADIYAH LUWUK BANGGAI091025Penelitian Dosen PemulaKode:RAHMAWATI HALIM S.Sos., M.Si.Efektivitas Program Corporate Social Responsibility (CSR) PT Donggi Senoro LNG di Desa Uso Kecamatan Batui Kabupaten Banggai 2780BaruStatus usulan:0015017205UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:ANDI MUNAFRI D MAPPATUNRU S.H., M.H.AKSES KEADILAN BAGI MASYARAKAT MISKINStudi Implementasi Bantuan Hukum Bagi Masyarakat Miskin Dalam Criminal Justice System Di Kabupaten Banggai)2781BaruStatus usulan:0912098102UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:ZULHARBI AMATAHIRAnalisis Hukum Fungsi Dewan Perwakilan Rakyat Daerah Dalam Pengawasan APBD (Studi DPRD KAB.BANGGAI)2782BaruStatus usulan:0918027903UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:RAMLIPerilaku Ibu Bayi dalam pemberian ASI pada Etnis Banggai di Kecamatan Liang Kabupaten Banggai Kepulauan Sulawesi Tengah2783BaruStatus usulan:0925058702UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:348


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMARSELINA SATTUFAKTOR RISIKO KEJADIAN GIZI LEBIH PADA BALITA DIWILAYAH KERJA PUSKESMAS LUWUK KECAMATAN LUWUK KABUPATEN BANGGAI2792BaruStatus usulan:0905038702UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:STECY MARCYANDA LEGOHFAKTOR RISIKO KEJADIAN KANKER PAYUDARA DI KABUPATEN BANGGAI2793BaruStatus usulan:0928038501UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:FITRIANTY SUTADI LANYUMBAANALISIS SWOT PELAYANAN KESEHATAN RAWAT INAP PADA PUSKESMAS PERAWATAN DI KABUPATEN BANGGAI2794BaruStatus usulan:0930058702UNIVERSITAS TOMPOTIKA LUWUK BANGGAI091026Penelitian Dosen PemulaKode:Dr. Ir. MAJDAH MUHYDDIN ZAIN M.Si.Analisis Sistem produksi dan dayasaing beras berbasis kelompok dan pasar antar pulau secara berkelanjutan di Sulawesi Selatan2795BaruStatus usulan:0025116302UNIVERSITAS ISLAM MAKASSAR091028MP3EIKode:JAMALUDDIN STKAJIAN NUMERICAL TEGANGAN FRAME SEPEDA MOTOR MATIC AKIBAT BEBAN IMPULS MENGGUNAKAN SOFT COMPUTING MATLAB2796BaruStatus usulan:0920057904UNIVERSITAS ISLAM MAKASSAR091028Penelitian Dosen PemulaKode:M. RUSDI S.Si., Apt.EFEK HIPOGLIKEMIK KOMBINASI EKSTRAK ETANOL MURBEI Morus alba L.)DAN DAUN UBI JALAR UNGU (Ipomoea batatas L.) TERHADAP MENCIT JANTAN (Mus musculus)2797BaruStatus usulan:0907058304UNIVERSITAS ISLAM MAKASSAR091028Penelitian Dosen PemulaKode:ANDI HASLINDAH S.T., M.Si.Perancangan Sistem Kerja Mesin Perontok (Theriser) Mini Dengan Model Break Down Untuk Pedesaan2798BaruStatus usulan:0912087602UNIVERSITAS ISLAM MAKASSAR091028Penelitian Dosen PemulaKode:DEYVIE XYZQUOLYNA STPPengujian Beberapa Indikator Mutu Susu Kambing Peranakan Etawa (C. aegagrus) Segar(Penelitian Laboratorium)2799BaruStatus usulan:0905128201UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:350

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABENNY RUMAMBIEPENGARUH DUKUNGAN ORGANISASI DAN KOMPETENSI TERHADAP KEPUASAN KERJA SERTA IMPLIKASINYA TERHADAP ORGANIZATIONAL CITIZENSHIP BEHAVIOR PADA PEGAWAI DINAS DINAS PERTANIAN DAN KETAHANAN PANGAN PROVINSI GORONTALO2800BaruStatus usulan:0909027501UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:ERSE DRAWANA PERTIWI SPPemetaan Produksi Jagung Secara Spasial Berdasarkan Waktu Tanam di Kabupaten Pohuwato, Gorontalo2801BaruStatus usulan:0908018703UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:ANDI SUBHANTingkat Pemahaman Pedagang Kaki Lima (PKL) Tentang Informasi Tata Ruang dan Pengaruhnya Terhadap Perilaku Penggunaan Lahan Publik di Kota Gorontalo2802BaruStatus usulan:0923098001UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:ARIFIN S.E., M.SiANALISIS IMPLEMENTASI STRATEGI TERHADAP CAPAIAN KINERJA PERUSAHAAN (Studi Pada PT. (Persero) Perusahaan Listrik Negara Cabang Gorontalo)2803BaruStatus usulan:0907077401UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:DARMIATI DAHAR SPAnalisis Faktor-Faktor yang Mempengaruhi Produksi Bawang Merah di Kabupaten Pohuwato, Provinsi Gorontalo2804BaruStatus usulan:0918088601UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:MUHAMMAD SUDIRMAN AKILI STPPengaruh Gliserol Terhadap Karakteristik Kemasan Edible Film Berbasis Pektin (Penelitian Laboratorium)2805BaruStatus usulan:0905108501UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:MUAMMAR Z STANALISIS IMPLEMENTASI STATIC SYNCHRONOUS COMPENSATOR (STATCOM) UNTUK MENGANTISIPASI FLUKTUASI TEGANGAN PADA SALURAN TRANSMISI 150 KV SISTEM GORONTALO2806BaruStatus usulan:0906018701UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:MILAWATI LALLA SP.,MPEfektivitas dan Waktu Pemberian Pupuk Nitrogen terhadap Hasil Tanaman Kacang Tanah (Arachis hypogaea L.)2807BaruStatus usulan:0914117701UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:351

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAROSMINA HIOLA SE, M.SiPengaruh Variabel Karakteristik, motivasi kerja dan Sistem Imbalan, terhadap Kinerja Karyawan dan Implikasinya terhadap Kepuasan Kerja Karyawan (Studi Pada Perusahaan Supermarket di Gorontalo)2808BaruStatus usulan:0922116601UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:MELINDA IBRAHIMPENGARUH KARAKTERISTIK PERUSAHAAN TERHADAP LUAS PENGUNGKAPAN CORPORATE SOCIAL RESPONSIBILITY (CSR)DAN DAMPAKNYA TERHADAP NILAI PERUSAHAAN2809BaruStatus usulan:0920058601UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:DINA MARIANIOptimasi Penjadwalan Pembangkit Termal pada Sistem Interkoneksi 150 kV Gorontalo Menggunakan Metode Langrange dan Dinamic Programing2810BaruStatus usulan:0905058701UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:ASNIWATI ZAINUDDIN S.TPAnalisis dan Aplikasi Gum Xanthan Terhadap Produk Susu Kedelai (Penelitian Laboratorium)2811BaruStatus usulan:0931018601UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:RADEN FATAHILLAH SPSTATUS KETERSEDIAAN AIR TANAH BERDASARKAN NERACA AIR PADA LAHAN KERING DESA BUHU KECAMATAN TELAGA JAYA KABUPATEN GORONTALO2812BaruStatus usulan:0931126922UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:ZULHAM S.TPStudi Tentang Faktor-faktor yang Mempengaruhi Adopsi Teknologi pada Usahatani Cabai Rawit di Sentra Produksi Cabai Rawit di Desa Butu, Kecamatan Tilong Kabila, Gorontalo2813BaruStatus usulan:0911108104UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:AZMINUDDIN I. S. AZIS S.KOMINTEGRASI ALGORITMA SINGULAR VALUE DECOMPOSITION (SVD) DAN PRINCIPAL COMPONENT ANALYSIS (PCA) UNTUK PENGURANGAN DIMENSI PADA DATA REKAM MEDIS2814BaruStatus usulan:0914107901UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:REYTHER BIKI SEMOTIVASI KERJA SEBAGAI PEMODERASI HUBUNGAN ANTARA PARTISIPASI ANGGARAN DENGAN KINERJA MANAJERIAL2815BaruStatus usulan:0927077001UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:352

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAUMAR ST., MT.TIPOLOGI ARSITEKTUR KOLONIAL BELANDA (Study Kasus : Bangunan Heritage di Gorontalo)2816BaruStatus usulan:0910087301UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:SABHAN KANATA STPemodelan Pembangkit Hybrid Berbasis Energi Terbarukan Menuju Desa Mandiri Energi di Kabupaten Bone-Bolango2817BaruStatus usulan:0912117603UNIVERSITAS ICHSAN GORONTALO091033Penelitian Dosen PemulaKode:MUHAMMAD IHSAN MATTALITTI S.Sos., M.A.Analisa Ketahanan Penghidupan Tiga Komunitas Petani di Wilayah Penambangan Nikel Kabupaten Konawe Selatan2818BaruStatus usulan:0907077901UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:SUHARTA AMIJAYAH H.LAJU SEDIMENTASI TERHADAP EKOSISTEM TERUMBU KARANG AKIBAT PENAMBANGAN NIKEL DI DESA BANDAEHA KECAMATAN BANDAEHA KABUPATEN KONAWE UTARA2819BaruStatus usulan:0908038202UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:LELY OKMAWATY ANWAR S.PiPOTENSI TAMBELO (Bactronophorus sp) SEBAGAI FLAVOR ENHANCER 2820BaruStatus usulan:0905108402UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:FERA SARI S.Pi, M.SiStudi Kelayakan Drainase Berwawasan Lingkungan Yang Bermuara pada Teluk Kendari di kelurahan Mandonga Sebagai Upaya Penanggulangan Banjir di Kota Kendari Provinsi Sulawesi Tenggara2821BaruStatus usulan:0917068301UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:NASIRPartisipasi Wanita Dalam Pendidikan Pada Masyarakat Desa Ululakara Konawe Selatan-Sulawesi Tenggara2822BaruStatus usulan:0919068301UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:Ir HARTATI M.SiModel Sistem Integrasi Usaha Ternak Ayam Pedaging dan Itik Manila (entok) di Kabupaten Konawe Selatan2823BaruStatus usulan:0921046403UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:353

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASITTI ZAKIAH MAMUNPeran strategis lembaga keuangan dalam mendorong peningkatan kinerja UKM menyongsong pasar global ASEAN (studi pada UKM kota kendari)2824BaruStatus usulan:0924047102UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:SYAMSINAR S.P., M.SiKontribusi Usaha Perempuan Pemecah Batu Dalam Meningkatkan Pendapatan Rumah Tangga Di Kecamatan Napabalano Kabupaten Muna2825BaruStatus usulan:0914117603UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:ABDUL RAHMAN S.Sos., M.SiPENGARUH BUDAYA ORGANISASI BPP RANOMEETO BARAT DAN HUBUNGAN ANTARORGANISASI TERHADAP KINERJA ORGANISASI BPP RANOMEETO BARAT 2826BaruStatus usulan:0906097705UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:LA ODE ALIMUSAAnalisis Faktor-faktor yang Mempengaruhi Keputusan Konsumen dalam Menggunakan Produk Bank Syariah di Kota Kendari Propinsi Sulawesi Tenggara (studi Kasus, BNI Syariah cab. Kendari, BMI Cab. Kendari, dan BSM Cab. Kendari) 2827BaruStatus usulan:0903078402UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:MULIYANIPenerapan Model Pembelajaran Kooperatif Tipe NHT dalam Pembelajaran Qur'an Hadis terhadap Hasil Belajar Peserta Didik (Studi Eksperimen pada Kelas VIII Madrasah Tsanawiyah PESRI Kota Kendari)2828BaruStatus usulan:0906068104UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:SITTI ROSMALAH S.P., M.PINTERNALISASI PEMANFAATAN SUMBERDAYA HUTAN YANG BERWAWASAN LINGKUNGAN PADA MASYARAKAT PETANIHUTAN RAKYAT KABUPATEN KONAWE SELATAN2829BaruStatus usulan:0920118002UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:NURZAIMAPENGEMBANGAN PENDIDIKAN KARAKTER BERBASIS BUDAYA LOKALDI SMA MUHAMMADIYAH RAHA2830BaruStatus usulan:0908117802UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:S.Pi AMIR MAHMUD M.PKondisi Populasi Ketam Kelapa (Birgus latro) Sebagai Hewan Endemik di Pulau Labengki Kec. Lasolo Kab. Konawe Utara2831BaruStatus usulan:0902017601UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:354

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAARFINPeranan Nilai-Nilai Kearifan Lokal Budaya Pokadulu (Kerja Sama) Dalam Mewujudkan Pelayanan Administrasi Sekolah yang Berkualitas Pada SMA Negeri 1 Napabhalano Kecamatan Napabalano Kabupaten Muna-Sulawesi Tenggara2832BaruStatus usulan:0911108403UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:TITIN RAHMIATINAnalisis Kesalahan Menulis (Writing) Siswa Kelas II di SMA Negeri 1 Besulutu Kabupaten Konawe Sulawesi Tenggara2833BaruStatus usulan:0909028302UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:ARY TAMTAMAPEMANFAATAN CACING TEMBELU (Bactronophorus thoracites) SEBAGAI PRODUK NUTRACEUTICAL 2834BaruStatus usulan:0915018202UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:BAMBANG INDRO YUWONOAnalisis Opportunity Cost Dalam Prosesing Biji Kakao Untuk Memenuhi SNI 01-2323-2008 di Kecamatan Poli-Polia, Kabupaten Kolaka Timur2835BaruStatus usulan:0908115001UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:RIRIN SYAHRIANIEvaluasi Manajemen Pembelajaran Writing di Universitas Muhammadiyah Kendari2836BaruStatus usulan:0915018502UNIVERSITAS MUHAMMADIYAH KENDARI091036Penelitian Dosen PemulaKode:SUFRI MASHURI S.Pd., M.PdMENINGKATKAN HASIL BELAJAR MATAKULIAH KALKULUS MELALUI MEDIA VISUAL MAHASISWA UNIVERSITAS 19 NOVEMBER KOLAKA2837BaruStatus usulan:0013117902UNIVERSITAS 19 NOVEMBER KOLAKA091038Penelitian Dosen PemulaKode:WAHYUDDINAplikasi Penggunaan Pupuk Organik Cair Terhadap Laju Pertumbuhan dan Produksi Rumput Laut (Eucheuma cottonii)2838BaruStatus usulan:0925107402UNIVERSITAS 19 NOVEMBER KOLAKA091038Penelitian Dosen PemulaKode:RAMLAH SEfektifitas Kebijakan Pemerintah Terhadap Tingkat Pendapatan Usaha Perikanan Tangkap Bagan Perahu Di Kab. Kolaka.2839BaruStatus usulan:0903036602UNIVERSITAS 19 NOVEMBER KOLAKA091038Penelitian Dosen PemulaKode:355

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI DAMAYANTI S.S., M.Hum.Designing Multimedia for Lecturers’ Need in Teaching English Pronunciation2840BaruStatus usulan:0016037902UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:PALDYTeaching English to the Students at Remote School (Implementation of Fun English Learning in Enhancing Students’ Vocabulary at SMP 1 Limbong)2841BaruStatus usulan:0920078501UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:NURURRAHMAH S.Si., M.Si.UJI EFEKTIVITAS Pistia stratiotes TERHADAP PENURUNAN KADAR COD PADA LIMBAH CAIR SAGU2842BaruStatus usulan:0909057802UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:SYAMSU ALAMPEMBELAJARAN METODE PENEMUAN TERBIMBING SETTING KOOPERATIF DENGAN MELIBATKAN GAYA KOGNITIF PADA MATA KULIAH TRIGONOMETRI2843BaruStatus usulan:0931128405UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:RIZAL A. M. SJACHRUNLesson Study: The Using of Peer Tutoring toward TEFL Course of Fourth Semester Student at English Department of Palopo Cokroaminoto University2844BaruStatus usulan:0903058302UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:SUKIMIN S.P.,M.P.Pertumbuhan dan Perkembangan Tanaman Padi (Oryza sativa L) Dengan Berbagai Dosis Pupuk dan Pestisida organik Di Kota Palopo2845BaruStatus usulan:0905077403UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:RUSMALAImplementasi Algoritma Kriptografi Kunci Public Menggunakan Metode Rivest Shamir Adleman (RSA) Pada File Text Dengan Algoritma The Sieve Of Eratosthenes Untuk Membangkitkan Bilangan Prima2846BaruStatus usulan:0908048303UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:DWI RISKY ARIFANTIPENGARUH GAYA BERPIKIR (MONARCHIC, HIERARCHIC, OLIGARCHIC, DAN ANARCHIC) TERHADAP KEMAMPUAN MENYELESAIKAN SOAL MATA KULIAH TRIGONOMETRI2847BaruStatus usulan:0927018601UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:356

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHAFIRAH PATANG S.S.Lesson Study: A Model for Improving Informatics Engineering Students' Achievement in English2848BaruStatus usulan:0926128301UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:RESKI PILUImproving Students' Writing Performance: A Self-Regulated Strategy Development2849BaruStatus usulan:0911118603UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:RAHMAN HAIRUDDINRESPON BAWANG MERAH (Allium ascalonicum) TERHADAP BERBAGAI DOSIS EKSTRAK KOTORAN AYAM POTONG2850BaruStatus usulan:0930077303UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:MULYANI MUNTAHAPEMBELAJARAN MODEL PROBLEM BASED LEARNING DAN ADVERSITY QUOTIENT DALAM PEMECAHAN MASALAH GEOMETRI ANALITIK BIDANG DAN RUANG2851BaruStatus usulan:0908118503UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:NISRAENIPengembangan Bahan Ajar Mata Kuliah Statistika Dasar dengan Penerapan Model Kooperatif Tipe TPS (Think-Pair-Share) melalui Program Lesson Study2852BaruStatus usulan:0916058701UNIVERSITAS COKROAMINOTO PALOPO091039Penelitian Dosen PemulaKode:TAKRILPENGARUH SALINITAS YANG BERFLUKTUASI TERHADAP SISTEM IMUN DAN EKSKRESI JUVENIL UDANG WINDU (Penaeus monodon Fabr.) 2853BaruStatus usulan:0910038106Universitas Sulawesi Barat091043Penelitian Dosen PemulaKode:TALHA DANGKUAANALISIS INTEGRASI KEPENDUDUKAN DALAM PEMBANGUNAN BERKELANJUTAN DI PROVINSI GORONTALO2854BaruStatus usulan:0929076501Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:ZURIATI MUHAMADSTUDI EVALUASI PROGRAM JAMINAN PERSALINAN (JAMPERSAL) DI DINAS KESEHATAN KABUPATEN GORONTALO 2855BaruStatus usulan:0922018502Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:357

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARAMLAH ALKATIRIMANAJEMEN POLA HIDUP BERSIH DAN SEHAT TERHADAP LANSIA DI PANTI WERDA KOTA GORONTALO2856BaruStatus usulan:0922026202Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:YUSRAN ZAINUDDINTINGGKAT PEMAHAMAN MASYARAKAT TERHADAP ANAK PUTUS SEKOLAHDI PROVINSI GORONTALO2857BaruStatus usulan:0929087201Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:MOHAMMAD S. DJAUSTUDI KOMUNITAS KARANG SCLERACTINIA SEBAGAI PENDUKUNG KEBERLANJUTAN PERIKANAN2858BaruStatus usulan:0902118203Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:DEWI SHINTA ACHMADKomposisi Hasil Tangkapan Utama, Sampingan,dan Buangan pada Bagan Perahu di Perairan Gorontalo2859BaruStatus usulan:0901128102Universitas Muhammadiyah Gorontalo091044Penelitian Dosen PemulaKode:NOSAKROS ARYA S.SosMEDIA DAN POLITIK LOKAL (STUDI RELASI 4 SURAT KABAR FAJAR GROUP DAN POLITIK LOKAL DI SULAWESI SELATAN)2860BaruStatus usulan:0918118501Universitas Fajar091045Penelitian Dosen PemulaKode:S.IP. DEDE ROHMANAnalisis Kritis Pelaksanaan Hubungan Luar Negeri Dalam Kerangka Otonomi Daerah di Kota Makassar2861BaruStatus usulan:0919057501Universitas Fajar091045Penelitian Dosen PemulaKode:ANDI NURALIYAH S.T.,M.T.Uji Keamanan Asap Cair Kulit Durian Sebagai Pengawet Pangan2862BaruStatus usulan:0920017403Universitas Fajar091045Penelitian Dosen PemulaKode:SYAMSUL ASRI S.IP.Analisis Pola Jaringan dan Modus Operandi People Smuggling Di Provinsi Sulawesi Selatan (Studi Kasus Kota Makassar dan Kabupaten Bulukumba)2863BaruStatus usulan:0926028502Universitas Fajar091045Penelitian Dosen PemulaKode:358

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAAFDAL SE., Ak.PENGARUH KOMITMEN PROFESIONAL DAN SOSIALISASI ANTISIPATIF TERHADAP SIKAP MAHASISWA AKUNTANSI ATAS AKUNTABILITAS SOSIAL PERUSAHAAN2864BaruStatus usulan:0909018801Universitas Fajar091045Penelitian Dosen PemulaKode:- ASMEATI STANALISIS PENGARUH PARAMETER PEMOTONGAN TERHADAP KONSUMSI ENERGI LISTRIK PADA PROSES PEMBUBUTAN 2865BaruStatus usulan:0901077405Universitas Fajar091045Penelitian Dosen PemulaKode:MELDAWATI ARTAYANI STPemanfaatan Sampah Kertas Menjadi Papan Partikel Sebagai Dinding Dekoratif Ruangan2866BaruStatus usulan:0922038103Universitas Fajar091045Penelitian Dosen PemulaKode:IRMAWATIPengaruh Board Diversity Dan Social Corporate Responsibility Terhadap Nilai Perusahaan 2867BaruStatus usulan:0925068203Universitas Patria Artha091047Penelitian Dosen PemulaKode:ANDI ASRIFAN S.Pd.,M.Pd.The 3-Dimention Pictures in Increasing the Students Ability and interest to Write Descriptive Composition 2868BaruStatus usulan:0931108503STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:ROSMINI KASMANKeefektifan Penggunaan Metode SQ3R pada Pembelajaran Membaca Kritis Teks Editorial Siswa SMK Kecamatan Maritengngae Kabupaten Sidrap2869BaruStatus usulan:0928087804STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:SUARDI ZAIN S.Pd., M.Pd.Efektivitas Strategi Show Not Tell terhadap Kemampuan Menulis Pengalaman Siswa kelas VIII SMP Negeri 1 Pancarijang Kabupaten Sidenreng Rappang”.2870BaruStatus usulan:0911107401STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:YUSMAHEfektivitas Pendekatan Kontekstual Learning Community dalam Pembelajaran Menulis Paragraf Persuasif di SMA Negeri 1 Panca Rijang Kabupaten Sidrap2871BaruStatus usulan:0918048506STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:359

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYULIANA S.Pd.I.,M.Pd.Improving Students' Speaking Ability through Drama Practice of the Sixth Semester of English department of STKIP Muhammadiyah Sidrap2872BaruStatus usulan:0930038202STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:HJ. GEMINASTITI SAKKIR S.Pd.,M.Pd.Using Movie to Improve Students' Vocabulary at SMP Negeri 1 Rappang2873BaruStatus usulan:0908068701STKIP MUHAMMADIYAH RAPPANG093004Penelitian Dosen PemulaKode:NENNY INDRAWATIANALISIS KEMAMPUAN PEMECAHAN MASALAH BERDASARKAN TINGKAT KOMPLEKSITAS MASALAH DAN PERBEDAAN GENDER MAHASISWA PENDIDIKAN MATEMATIKA STKIP YPUP MAKASSAR2874BaruStatus usulan:0914128605STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:Ir RUSLAN B S.Pd., M.PdPengembangan Perangkat Pembelajaran Matematika Model Kooperatif Berbasis Kontekstual Daerah Pesisir pada Siswa Kelas VII SMP Negeri 2 Pangkajene Kepulauan2875BaruStatus usulan:0930055802STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:FITRIANIAplikasi Persamaan Differensial Autonomous Termodifikasi dalam Menganalisa Kestabilan Model Interaksi Modal Usaha Kecil dan Menengah pada Pasar Tradisional Pa`Baeng-baeng Kota Makassar.2876BaruStatus usulan:0918108601STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:ASRAFIAHPemodelan Kasus Demam Berdarah Dengue dengan Menggunakan Pendekatan Regresi Spasial2877BaruStatus usulan:0926108701STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:SRI RAHAYUNINGSIHDESKRIPSI KEMAMPUAN PEMECAHAN MASALAH DAN KOMUNIKASI MATEMATIKA BERDASARKAN GAYA KOGNITIF PADA MAHASISWA STKIP YPUP MAKASSAR2878BaruStatus usulan:0908118602STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:JERANAHMENINGKATKAN KEMAMPUAN PEMECAHAN MASALAH DALAM PEMBELAJARAN MATEMATIKA DENGAN PENDEKATAN OPEN ENDED PROBLEM PADA SISWA KELAS XI IPA SMA NEGERI 1 SUGGUMINASA2879BaruStatus usulan:0921038801STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:360

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARINA ASRINI BAKRITypes of Corrective Feedback Used in Writing of English Department Students of STKIP YPUP Makassar2880BaruStatus usulan:0922018503STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:FAIHATUZ ZUHAIROHPersamaan Evolusi Proses Semi-Markov Homogen dalam Perhitungan Premi Tambahan Asuransi Kesehatan Rawat Jalan Penyakit ISPA2881BaruStatus usulan:0924078701STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:ANDI PATIMBANGI S.Pd,M.PdPengaruh Kecerdasan Intrapersonal dan Interpersonal dengan Melibatkan Metakognisi terhadap Hasil Belajar Matematika Siswa Kelas X MAN Binamu Jeneponto2882BaruStatus usulan:0927068501STKIP YPUP MAKASSAR093009Penelitian Dosen PemulaKode:M. IHSAN MALIK S.E.ANALISIS PENDAPATAN PEDAGANG BUAH-BUAHAN (STUDI KASUS KOTA MAKASSAR) 2883BaruStatus usulan:0912115602SEKOLAH TINGGI ILMU EKONOMI YPUP MAKASSAR093019Penelitian Dosen PemulaKode:ARIFIN S.Pd.,M.HumPENGGUNAAN DEIKSIS DI KALANGAN MAHASISWASTKIP PUANGRIMAGGALATUNG SENGKANG2884BaruStatus usulan:0905107305STKIP PUANGRIMAGGALATUNG SENGKANG093026Penelitian Dosen PemulaKode:AHMAD YANI S.PdPENGARUH PEMBERIAN PAKAN TANAMAN MURBEI Morus alba Dan Morus cathayana TERHADAP PRODUKSI KOKON ULAT SUTERA (Bombys Mori.L) Di KABUPATEN WAJO2885BaruStatus usulan:0913048801STKIP PUANGRIMAGGALATUNG SENGKANG093026Penelitian Dosen PemulaKode:EDY JUMADY SE., M.SiPENGARUH PRICE EARNING RATIO ( PER ) DAN PRICE TO BOOK VALUE RATIO ( PBV ) TERHADAP PENGUNGKAPAN CORPORATE SOCIAL RESPONSIBILITY (CSR) PADA INDUSTRI PERBANKAN YANG TERDAFTAR DI BURSA EFEK INDONESIA. 2886BaruStatus usulan:0909087801SEKOLAH TINGGI ILMU EKONOMI BONGAYA YPBUP MAKASSAR093027Penelitian Dosen PemulaKode:NIKEN PROBONDANI ASTUTIANALISIS PERSEPSI, PREFERENSI, SIKAP DAN PERILAKU MAHASISWA TERHADAP PERBANKAN SYARIAH2887BaruStatus usulan:0922067901SEKOLAH TINGGI ILMU EKONOMI BONGAYA YPBUP MAKASSAR093027Penelitian Dosen PemulaKode:361



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUBARAK NURU DAMIEksplorasi dan Karakterisasi jenis-jenis Tumbuhan Adaptif Pada Lahan Bekas Penambangan Aspal di Kabupaten Buton2904BaruStatus usulan:0912127904SEKOLAH TINGGI ILMU PERTANIAN W UNA RAHA093049Penelitian Dosen PemulaKode:WA ODE NURLINAnalisis Produksi Ikan Bandeng di Kabupaten Muna2905BaruStatus usulan:0912018101SEKOLAH TINGGI ILMU PERTANIAN W UNA RAHA093049Penelitian Dosen PemulaKode:LA SINAINIAnalisis Pola Kemitraan Agribisnis Padi Sawah di Kabupaten Muna2906BaruStatus usulan:0918098101SEKOLAH TINGGI ILMU PERTANIAN W UNA RAHA093049Penelitian Dosen PemulaKode:LA ODE HAMRUDIN MOMO SP., M.ScANALISIS VEGETASI HUTAN MANGROVE DI DESA WAMBONAKECAMATAN WAKORUMBA SELATAN2907BaruStatus usulan:0908068106SEKOLAH TINGGI ILMU PERTANIAN W UNA RAHA093049Penelitian Dosen PemulaKode:SALMAN S.Kom., M.T.IMPLEMENTASI QUICK RESPONSE CODE DAN TEKNIK ENKRIPSI BERLAPIS PADA PRIVATE KEY UNTUK ALGORITMA AES SEBAGAI PENGAMAN KEASLIAN DOKUMEN BERHARGA2908BaruStatus usulan:0025027801STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:AHYUNA S.Kom.,M.I.Kom.APLIKASI SISTEM PAKAR UNTUK MENDIAGNOSA PENYAKIT PADA NYAMUK BERBASIS WEB2909BaruStatus usulan:0914118501STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:- YESAYA TOMMY PAULUS S.Kom., M.T.Implementasi Pustaka Win32Api dalam Pengontrolan Lingkungan Windows2910BaruStatus usulan:0926117401STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:CUCUT SUSANTO S.Kom., M.Si.PEMBUATAN DAN REALISASI ALAT PEMOTONG ROTAN SEDERHANA BERBASIS MIKROKONTROLER DI CV. KARYA MULIA SIDRAP SULAWESI SELATAN2911BaruStatus usulan:0927117301STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:364

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIr. IRSAL M.T.PERANCANGAN PROTOTIPE OPTIMASI PEMANFAATAN AREA PARKIR MENGGUNAKAN MIKROKONTROLLER2912BaruStatus usulan:0911075701STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:SANTIIMPLEMENTASI TEKNOLOGI INFORMASI PADA ADMINISTRASI KEPENDUDUKAN DI TINGKAT PEDESAAN2913BaruStatus usulan:0917108201STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:- ANDI IRMAYANA S.Kom.,MT.Sistem Identifikasi Penyakit Kulit Pada Wajah Menggunakan Metode Neural Network Back Propagation (NNBP)2914BaruStatus usulan:0918098501STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:ERNI MARLINA S.Kom.,M.I.Kom.Pemanfaatan Teknologi Komunikasi Dan Informasi (Internet) Sebagai Sarana Pembelajaran Di Stmik Dipanegara Makassar2915BaruStatus usulan:0914037501STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:MUHAMMAD SYAHLAN NATSIR S.Kom.Perancangan Sistem Perparkiran Cerdas Berbasis Radio Frequency Identification(RFID) Terintegrasi Web2916BaruStatus usulan:0909118301STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:ERFAN HASMIN S.Kom.,MT.IMPLEMENTASI ALGORITMA JST HOPFIELD UNTUK APLIKASI PRAKIRAAN CUACA BERBASIS ANDROID 2917BaruStatus usulan:0908048701STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:INDO INTAN S.T., M.T.Identifikasi Pola terhadap Citra Kanker Tiroid Menggunakan Metode Gaussian Markov Random Field dengan Metode Klasifikasi Self Organizing Map Kohonen2918BaruStatus usulan:0929127802STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:APRIZAL S.Kom., M.M.PERANCANGAN APLIKASI UNTUK PERHITUNGAN GAJI KARYAWAN DENGAN MENGGUNAKAN METODE ACTIVITY BASED COSTING PADA PERUSAHAAN KEMBANG DJAWA MAKASSAR 2919BaruStatus usulan:0905038601STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:365

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFRANS NURMIANTO ALLO KENDEKPerancangan Aplikasi Integrasi dan Verifikasi Data Penduduk Penerima Bantuan Pemerintah di Kota Makassar2920BaruStatus usulan:0931037701STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:A AHMAD SUKARNA SJAHRIR S.Kom., M.Si.APLIKASI SISTEM PAKAR DALAM MENENTUKAN KRITERIA RUMAH TANGGA MISKIN DENGAN METODE FUZZY LOGIC PADA BADAN PUSAT STATISTIK MAKASSAR PROVINSI SUL-SEL2921BaruStatus usulan:0923077801STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:ABDUL IBRAHIM S.Kom.,M.MSI.Sistem Penunjang Keputusan Pemberian Bantuan Pemerintah Pada Masyarakat Pra Sejahtera Dengan Metode Analytical Hierarcy Process (AHP) Pada Kota Makassar2922BaruStatus usulan:0923037002STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:KOMANG ARYASA S.Kom.,M.T.Aplikasi Sistem Pakar Mendiagnosa Jenis Penyakit Malaria Dan Pengobatannya Menggunakan Metode Forward Chaining Dan Association Rule Analysis2923BaruStatus usulan:0901118402STMIK DIPANEGARA MAKASSAR093052Penelitian Dosen PemulaKode:RAHMAWATI S.K.M.,M.SiKebutuhan Tidak Terpenuhi (Unmet Need) Keluarga Berencana pada Pasangan Usia Subur di Kota Makassar2924BaruStatus usulan:0028077501SEKOLAH TINGGI ILMU KESEHATAN TAMALATEA MAKASSAR093066Penelitian Dosen PemulaKode:DIANA MIRJA TOGUBUAnalisis Faktor Predisposisi Ibu Hamil Pada Pemeriksaan Kehamilan (ANC) Di Wilayah Kerja Puskesmas Payahe Kota Tidore Kepulauan 20132925BaruStatus usulan:0916128105SEKOLAH TINGGI ILMU KESEHATAN TAMALATEA MAKASSAR093066Penelitian Dosen PemulaKode:MUHAMMAD RISAL S.Kom,MTSISTEM MONITORING AREA DENGAN KAMERA BERGERAK BERBASIS WEB2926BaruStatus usulan:0920087704STMIK HANDAYANI MAKASSAR093069Penelitian Dosen PemulaKode:MUHAMMAD NADZIRIN ANSHARI NUR S.KomRancang Bangun Authoring Tool Animasi untuk Pembuatan Media Pembelajaran berbasis Template dan Library 2927BaruStatus usulan:0904117902STMIK HANDAYANI MAKASSAR093069Penelitian Dosen PemulaKode:366



NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAA. HERWATIEfisiensi Teknis, Risiko Produksi dan Pendapatan Usahatani Padi di Sawah tadah Hujan2944BaruStatus usulan:0914017302SEKOLAH TINGGI ILMU PERTANIAN YAPIM MAROS093127Penelitian Dosen PemulaKode:NINING HAERANIAnalisis Pendapatan dan Ketahanan Pangan Rumah Tangga Petani Berdasarkan Kepemilikan Lahan pada Usahatani Padi2945BaruStatus usulan:0927067501SEKOLAH TINGGI ILMU PERTANIAN YAPIM MAROS093127Penelitian Dosen PemulaKode:MOHAMMAD ANWAR SADAT S.P., M.SiAnalisis Faktor Produksi, Pendapatan dan Efisiensi Teknis Usahatani Padi Pola Pertanaman IP 200 di Sawah Tadah Hujan2946BaruStatus usulan:0924097702SEKOLAH TINGGI ILMU PERTANIAN YAPIM MAROS093127Penelitian Dosen PemulaKode:Ir. SAMSU A GAFFAR M.M.Analisis Risiko dan Pendapatam Usahatani Padi Berdasarkan Kepemilikan Lahan2947BaruStatus usulan:0915086602SEKOLAH TINGGI ILMU PERTANIAN YAPIM MAROS093127Penelitian Dosen PemulaKode:ANDI LUKMANMACHINE LEARNING MULTI KLASIFIKASI CITRA DIGITAL2948BaruStatus usulan:0922057801STIMED NUSA PALAPA093129Penelitian Dosen PemulaKode:MUHLISPemanfaatan Biopori Sebagai Alternatif Untuk Mengurangi Kerusakan Lingkungan2949BaruStatus usulan:0911118504SEKOLAH TINGGI TEKNOLOGI NUSANTARA INDONESIA093142Penelitian Dosen PemulaKode:NUR KHAIRIPengaruh Penamabahan Ekstrak Daun Cengkeh (Szigium aromaticum) dan stabilizer Kitosan Terhadap Kestabilan Ag Nanopartikel2950BaruStatus usulan:0914048401SEKOLAH TINGGI ILMU FARMASI MAKASSAR093143Penelitian Dosen PemulaKode:FITRIYANTI JUMAETRI SAMIUji Aktivitas Antioksidan Ekstrak Metanol Bunga Brokoli (Brassica oleracea L. var Italica) dengan Metode DPPH (2,2 diphenyl-1picrylhydrazyl) dan Metode ABTS (2,2 azinobis (3-etilbenzotiazolin)-6-asam sulfonat)2951BaruStatus usulan:0903068602SEKOLAH TINGGI ILMU FARMASI MAKASSAR093143Penelitian Dosen PemulaKode:369


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUHAJIRINLayanan Predikisi Bencana Multi Algoritma2960BaruStatus usulan:0915128002STMIK AKBA093166Penelitian Dosen PemulaKode:IKHWANAnalisa Hubungan Karakteristik Perawat dengan Tingkat Kepatuhan Perawat dalam Melaksanakan Prosedur Tetap Pemasangan Infus di IGD RS Nene Malomo Kabupaten Sidrap2961BaruStatus usulan:0917037001STIKES Muhammadiyah Sidrap093175Penelitian Dosen PemulaKode:KASSAMINGFaktor Yang Berhubungan dengan Sikap Remaja terhadap Kecenderungan melakukan Hubungan Sex Pranikah di SMA Muhammadiyah Sidrap2962BaruStatus usulan:0915078603STIKES Muhammadiyah Sidrap093175Penelitian Dosen PemulaKode:RATNA MAHMUD S.Kep.Ns,M.KesSIKAP DAN PENGETAHUAN PERAWAT BEDAH TERHADAP DETEKSI DINI GANGGUAN MIKROVASKULER PADA KAKI DIABETIK DALAM PENCEGAHAN AMPUTASI DI RS TK II PELAMONIA MAKASSAR 2963BaruStatus usulan:0925077602AKADEMI KEPERAWATAN MUHAMMADIYAH MAKASSAR094015Penelitian Dosen PemulaKode:ANDI HASNAH S.K.M.,M.KesFaktor - Faktor Yang Berhubungan Dengan Kejadian Keputihan Pada wanita Usia Subur Di RSUD Syekh Yusuf Gowa Tahun 20132964BaruStatus usulan:0919076901AKADEMI KEBIDANAN MUHAMMADIYAH MAKASSAR094072Penelitian Dosen PemulaKode:NURDIANA M.KesFaktor-Faktor Yang Berhubungan Dengan Kejadian Kehamilan Serotinus di RSUD Haji Makassar2965BaruStatus usulan:0910037901AKADEMI KEBIDANAN MUHAMMADIYAH MAKASSAR094072Penelitian Dosen PemulaKode:MASYKURIAHFAKTOR FAKTOR YANG MEMPENGARUHI KEJADIAN ANEMIA PADA IBU HAMIL DI RSKD IBU DAN ANAK SITI FATIMAHMAKASSAR TAHUN 20122966BaruStatus usulan:0923017201AKADEMI KEBIDANAN MUHAMMADIYAH MAKASSAR094072Penelitian Dosen PemulaKode:ST. HADIJAH S.Kep,M.KesFAKTOR-FAKTOR YANG MEMPENGARUHI TERJADINYA ABORTUS SPONTAN DI RSUD HAJI MAKASSAR TAHUN 20122967BaruStatus usulan:0921076702AKADEMI KEBIDANAN MUHAMMADIYAH MAKASSAR094072Penelitian Dosen PemulaKode:371

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADAHNIAR S.ST.,M.Kes.FAKTOR – FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN IKTERUS NEONATORUM DI RSKD IBU DAN ANAK SITI FATIMAH MAKASSAR2968BaruStatus usulan:0907077702AKADEMI KEBIDANAN MUHAMMADIYAH MAKASSAR094072Penelitian Dosen PemulaKode:IMAM PRIBADIPengaruh Pemahaman Agama Islam terhadap Perilaku Ibu Menyusui di Kota Palopo2969BaruStatus usulan:0903068202AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:ASMAWATIFaktor Yang Mempengaruhi Sikap Pekerja Seks Komersial Terhadap Kejadian Aborsi Provokatus Kriminalis di Kota Palopo2970BaruStatus usulan:0927038502AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:YULI SETIAWATIFaktor-Faktor yang Menpengaruhi Partisipasi Pria dalam Keluarga Berencana Di Kecamatan Wara Selatan Kota Palopo2971BaruStatus usulan:0915078601AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:PATMAWATIPengaruh Motivasi terhadap Kinerja Bidan pada Puskesmas Rawat Inap di Kota Palopo2972BaruStatus usulan:0907118301AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:HIKMAHubungan Senam Nifas Dengan Perubahan Tinggi Fundus Uteri Ibu Masa Nifas Hari Ketujuh Di Rumah Sakit Umum Daerah Sawerigading Palopo 2973BaruStatus usulan:0912038201AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:HASRIDA MUSTAFAFaktor-Faktor yang Berhubungan Dengan Sikap Siswa SMA Terhadap Hubungan Seksual (intercourse) Pranikah Di Kota Palopo2974BaruStatus usulan:0915048401AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:TASLIMPengaruh Karakteristik Organisasi Terhadap Motivasi Kerja Penyuluh Lapangan Keluarga Berencana (PLKB) Di Kota Palopo2975BaruStatus usulan:0928098602AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:372

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMURNI MURSYIDPENGARUH PENGETAHUAN DAN KEAKTIFAN MAHASISWI TINGKAT III AKBID MUHAMMADIYAH PALOPO DALAM PENGISIAN PARTOGARAF TAHUN 20132976BaruStatus usulan:0929058402AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:EVYLANIPengaruh Kepemimpinan Terhadap Kinerja Dosen Terhadap Program Studi Diploma III Kebidanan Pada Perguruan Tinggi Swasta Kesehatan Di Kota Palopo2977BaruStatus usulan:0921108401AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:MARDIANA AHMAD M.KebHubungan minat ibu dengan pemilihan alat kontrasepsi AKDR di wilayah Puskesmas Kota Palopo2978BaruStatus usulan:0904096801AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:SUHANDRA MAKKASAUAnaliis Permintaan Jasa Pelayanan Kesehatan pada Klinik Bersalin di Kota Palopo2979BaruStatus usulan:0909108501AKADEMI KEBIDANAN MUHAMMADIYAH PALOPO094085Penelitian Dosen PemulaKode:Ns. AGUSTINA S.Kep, M.KesEFEKTIVITAS INDIKATOR C REAKTIVE PROTEIN SELAKU DETEKSI DINI PREEKLAMPSIA DALAM KEHAMILAN2980BaruStatus usulan:0925086201AKADEMI KEPERAWATAN FATIMA PARE-PARE094090Penelitian Dosen PemulaKode:HENRICK SAMPEANGIN S.Kep,M.KesMODEL INTERVENSI PENYADARAN INISIASI MENYUSU DINI PADA IBU HAMIL KLASTER PEDESAAN DAN PERKOTAAN DI KOTA PAREPARE2981BaruStatus usulan:0901107104AKADEMI KEPERAWATAN FATIMA PARE-PARE094090Penelitian Dosen PemulaKode:SYAMSU NUR S.FarmPembuatan Natrium Karboksimetil selulosa (Na. CMC) dari limbah kulit pisang (Musa Paradisiaca L)2982BaruStatus usulan:0919038801AKADEMI FARMASI KEBANGSAAN MAKASSAR094094Penelitian Dosen PemulaKode:MICHRUN NISA S.FarmFORMULASI TABLET SELF EMULSIFYING GLIBENKLAMID DAN UJI IN VITRO DISOLUSI2983BaruStatus usulan:0921108404AKADEMI FARMASI KEBANGSAAN MAKASSAR094094Penelitian Dosen PemulaKode:373

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMIMING BERLIAN HI. B. SALAMKOMPATIBILITAS EKSTRAK TUMBUHAN LOKAL LEMBAH PALU DAN PENGEMBANGAN FORMULASI EKSTRAKNYA SEBAGAI INSEKTISIDA BIORASIONAL2984BaruStatus usulan:0923057302Politeknik Palu095005Penelitian Dosen PemulaKode:IMMU PUTERI SARIANALISIS HARGA POKOK PRODUKSI UNTUK MENENTUKAN HARGA JUAL BATU BATA (Studi Kasus: CV Putra Asnas Pariaman)2985BaruStatus usulan:1019098502UNIVERSITAS MUHAMMADIYAH SUMATERA BARAT101002Penelitian Dosen PemulaKode:WILLY NOFRANITAJenis dan Kegunaan Informasi yang dibutuhkan Dewan Perwakilan Rakyat Daerah Terhadap Laporan Keuangan Pemerintahan Daerah2986BaruStatus usulan:1026117201UNIVERSITAS MUHAMMADIYAH SUMATERA BARAT101002Penelitian Dosen PemulaKode:ITA PUSPITA SARIIdentifikasi Variabel-variabel Pembangunan Lembaga Kesatuan Pemangkuan Hutan Konservasi (KPHK) Sumatera Barat Dalam Upaya Mewujudkan Good Forestry Governance2987BaruStatus usulan:1002028501UNIVERSITAS MUHAMMADIYAH SUMATERA BARAT101002Penelitian Dosen PemulaKode:EDISONDesentralisasi Kebijakan Pendidikan: Penyusunan Model Kebijakan Sekolah Unggulan Ramah Sosial Di Kota Padang (Studi Terhadapkebijakan Sistem Pembiayaan Mantan Rintisan Sekolah Bertaraf Internasional (Eks-RSBI) Di Kota Padang Paska Pembatalan Kebijakan SBI2988BaruStatus usulan:1030128601UNIVERSITAS EKASAKTI101003Penelitian Dosen PemulaKode:ALFIAN ASRI SPt, MPSuplementasi Cairan Folikel Degraff Sapi terhadap Pematangan Oosit Kerbau Secara In Vitro2989BaruStatus usulan:1031057703UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:RINI FRIMAAnallisa Tingkat Kemiskinan Calon Pemanfaat Program Peningkatan Kapasitas Yang Mendukung Kualitas dan Produktifitas Masyarakat PNPM Kecamatan Gunung Talang Kabupaten Solok2990BaruStatus usulan:1002118401UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:NONA PERTA S.Pd, M.PdPenerapan media pembelajaran di Sekolah Praktek (Studi kasus pada mahasiswa FKIP UMMY Solok yang Praktek Lapangan Kependidikan (PLK) Semester Ganjil 2013/2014)2991BaruStatus usulan:1004028301UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:374

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANETTY INDRAWATI SE , MMPerhitungan Harga Pokok Produk Dalam Penentuan Harga Jual Bagi Pengusaha Rendang (Usaha Rumah Tangga) Agar Dapat Menciptakan Lapangan Kerja Sehingga Menambah Income Rumah Tangga.2992BaruStatus usulan:1026025801UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:IDA NIRWANA SE, M.SiPeranan Tunjangan Penghasilan Terhadap Kinerja Perangkat Nagari diKecamatan Kubung Kabupaten Solok2993BaruStatus usulan:1009047102UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:RASIDAH NASRAHPengaruh Kompensasi dan Lingkungan Kerja Non Fisik terhadap Disiplin dan Kinerja Karyawan Hotel Alana di Kota Padang Pasca Gempa2994BaruStatus usulan:1002068201UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:LILI WAHYUNI SE. M.Sipengaruh motivasi belajar dan tingkat intelegensi serta minat belajar terhadap prestasi belajar (studi empiris mahasiswa akuntansi PTS se kota padang2995BaruStatus usulan:1008017801UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:AFRAHAMIRYANOPengembangan e-Learning pada Mata Kuliah Metode Penelitian Pendidikan di Fakultas Keguruan dan Ilmu Pendidikan Universitas Mahaputra Muhammad Yamin2996BaruStatus usulan:1009048501UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:SUHARTINAAnalisis Efisiensi Penggunaan Faktor-Faktor Produksi dan Skala Produksi UsahataniPadi Sawah di Kenagarian Tanah Garam Kabupaten Solok2997BaruStatus usulan:1012126404UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:DARA SURTINA S.Pt., M.P.Suplementasi serum sapi terhadap kualitas spermatozoa cauda epididymis sapi dalam bahan pengencer tris-kuning telur setelah tahap equilibrasi2998BaruStatus usulan:1023046901UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:AFNI YENI SE, MMPengaruh Accessibility Terhadap Minat Nasabah Bertransaksi di Bank Syariah ( Studi kasus Bank Nagari Cabang Solok) 2999BaruStatus usulan:1019046901UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:375

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWAHYU INDAH MURSALINI SE, MMFakto-Faktor Yang Mempengaruhi Tingkat Keberhasilan Penerapan Sistem Bill Dalam Pemungutan Pajak Hotel Dan Restoran Di Kota Solok3000BaruStatus usulan:1019017402UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:DELSI AFRINIAnalisis Efisiensi dan KeuntunganUsaha Tani Jagung Serta Pemanfaatan Limbahnya Untuk Pakan Ternak Kecamatan Lubuk Sikarah kabupaten Solok3001BaruStatus usulan:1013047801UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:MAIDIL LAILIAN ANALYSIS OF STUDENTS’ GRAMMAR ABILITY IN USING PHRASAL VERBSAT THIRD YEAR STUDENTS OF ENGLISH DEPARTMENT OF FKIP UMMY SOLOK IN 2013-2014 ACADEMIC YEAR3002BaruStatus usulan:1010058102UNIVERSITAS MAHAPUTRA MUHAMMAD YAMIN101004Penelitian Dosen PemulaKode:MARDIUS S.H., M.H.Efektivitas Penyelesaian Sengketa Perdata Dengan Cara Mediasi Di Wilayah Hukum Pengadilan Negeri Padang 3003BaruStatus usulan:1029086201UNIVERSITAS TAMANSISWA101005Penelitian Dosen PemulaKode:Ir ERWIN -Dinamika Kegiatan Pacu Kuda dan Implikasi Terhadap Perkembangan Peternakan Kuda Pacu di Sumatera Barat3004BaruStatus usulan:0015046103UNIVERSITAS TAMANSISWA101005Penelitian Dosen PemulaKode:ALFATRI ANOM SH. MHDampak Sistem Binaan Terhadap Perubahan Perilaku Anak Nakal (Studi di Lembaga Pemasyarakatan Anak Klas II B Tanjung Pati)3005BaruStatus usulan:1010088502UNIVERSITAS TAMANSISWA101005Penelitian Dosen PemulaKode:HENNY SYAFITRI SE. MSiAnalisis Faktor-Faktor Yang Mempengaruhi KeterlambatanPenyelesaian Proyek Pembangunan Jalan(Studi UPTD Peralatan Dinas Pekerjaan Umum Kabupaten Solok)3006BaruStatus usulan:1027077001UNIVERSITAS TAMANSISWA101005Penelitian Dosen PemulaKode:JONI ZULHENDRA S.HI, MAMOTIVASI BERBUSANA MUSLIMAH MAHASISWI UNIVERSITAS TAMANSISWA PADANG3007BaruStatus usulan:1002118402UNIVERSITAS TAMANSISWA101005Penelitian Dosen PemulaKode:376


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADrs MUHAMMAD THAMRIN M.MAKSELERASI PENYEDIAAN LAPANGAN PEKERJAAN TERHADAP PENYERAPAN TENAGA KERJA SEKTOR INDUSTRI DI KOTA PEKANBARU3016BaruStatus usulan:1019045801UNIVERSITAS LANCANG KUNING101007Penelitian Dosen PemulaKode:DWIKA LODIA PUTRIPengaruh Ketidak Pastian Lingkungan Terhadap Karakteristik Sistem Imformasi Akuntansi Manajemen Pada Bank Syariah Mandiri Pekanbaru3017BaruStatus usulan:1012066201UNIVERSITAS LANCANG KUNING101007Penelitian Dosen PemulaKode:SRI RAHAYU PRASTYA NINGSIH S.Hut., M.P.PEMANTAUAN KESEHATAN HUTAN KOTA PEKANBARU 3018BaruStatus usulan:1001017201UNIVERSITAS LANCANG KUNING101007Penelitian Dosen PemulaKode:MARTALASARIIdentifikasi Serangga Dekomposer dipermukaan Tanah Hutan Tropis Dataran Rendah (studi kasus di Arboretum Universitas Lancang Kuning dengan luas 9,2 Ha)3019BaruStatus usulan:1001037904UNIVERSITAS LANCANG KUNING101007Penelitian Dosen PemulaKode:SYAHDANCOLLABORATIVE ACTION RESEARCH UNTUK MENINGKATKAN PARTISIPASI MAHASISWA DALAM DISKUSI KELAS MELALUI PENGGUNAAN SKYPE PADA MATA KULIAH SPEAKING II3020BaruStatus usulan:1015087803UNIVERSITAS LANCANG KUNING101007Penelitian Dosen PemulaKode:HELFI AGUSTIN SKM., MKMHubungan Kandungan Yodium Air Minum dan Penatalaksanaan Garam Beryodium di Rumah Tangga dengan Prevalensi Gangguan Akibat Kekurangan Yodium (GAKY) di Kota Padang, Tahun 20133021BaruStatus usulan:0015087410UNIVERSITAS BAITURRAHMAH101009Penelitian Dosen PemulaKode:HARY BUDIMANPERANCANGAN SISTIM PENDUKUNG PENATAAN PERSYARATAN JABATAN SESUAI KOMPETENSI DI DIREKTORAT UMUM, SDM DAN PENDIDIKAN RSUP Dr. M. DJAMIL PADANG TAHUN 20133022BaruStatus usulan:1006097602UNIVERSITAS BAITURRAHMAH101009Penelitian Dosen PemulaKode:FAKHNI ARMENPERBANDINGAN AKURASI CAPITAL ASSET PRICING MODEL DAN ARBITRAGEPRICING THEORY DALAM MEMPREDIKSI RETURN SAHAM INDUSTRIOTOMOTIF DAN FARMASI SEBELUM DAN SESUDAH KENAIKAN HARGA BBMTAHUN 20133023BaruStatus usulan:1019056501UNIVERSITAS BAITURRAHMAH101009Penelitian Dosen PemulaKode:378

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMUHAMAD FITRI S.T., M.SiAnalisis performansi / Prestasi penggunaan 2 Pompa yang spesifikasinya bertolak belakang dipasang secara seri dan Paralel3024BaruStatus usulan:1013126901UNIVERSITAS BATAM101010Penelitian Dosen PemulaKode:MUHAMMAD WAHYUDIAnalisi Pelaksanaan Tanggungjawab Sosial dan Praktik Akuntansi Sosial Pada Perusahaan Manufaktur di Provinsi Kepulauan Riau3025BaruStatus usulan:1002088001UNIVERSITAS BATAM101010Penelitian Dosen PemulaKode:ELY KURNIAWATIPENELITIAN TERHADAP PERSEPSI DAN HARAPAN KUALITAS JASA, SERTA KEPUASAN PENGGUNA JASA PEMBUATAN PASPOR RI DI KANTOR IMIGRASI KELAS I BATAM3026BaruStatus usulan:1028098302UNIVERSITAS BATAM101010Penelitian Dosen PemulaKode:AGUSTINA FITRIANINGRUMPengembangan Instrumen Pengukuran Kinerja Ekspor Pada Perusahaan Elektronik Di Kawasan Free Trade Zone, Indonesia3027BaruStatus usulan:1029087902UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:DANIEL CASSAAnalisis Dampak Standarisasi Makanan Dan Minuman Singapura Terhadap Minat Beli Wisatawan Singapura Akan Cake Sebagai Oleh Oleh Dari Kota Batam3028BaruStatus usulan:0410088403UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:YUNIANSYAHANALISIS DAN PENGEMBANGAN MULTIMEDIA PEMBELAJARAN MATA KULIAH OPERASIONAL DAPURMENGGUNAKAN METODE ADDIE3029BaruStatus usulan:0228067001UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:ISKANDAR ITANImplikasi Corporate Governance terhadap Kinerja Family Business di Indonesia3030BaruStatus usulan:1014096201UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:HEPY HEFRI ARIYANTO SE., MM.Analisis Anteseden dan Dampak Place Attachment terhadap Keinginan untuk Berkunjung Kembali (Studi pada Wisatawan Mancanegara di Batam) 3031BaruStatus usulan:1018017302UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:379


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAWISHNU KURNIAWANAnalisa Yuridis Dampak Layanan Pemerintahan Terhadap Konsistensi Pelaksanaan Peraturan Pemerintah Nomor 47 Tahun 2007 Tentang Organisasi Perangkat Daerah Di Daerah Pemekaran (Studi Kasus Di Kabupaten Lingga)3040BaruStatus usulan:1024018202UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:NONA MAHDITIARA ARYUNIPENGEMBANGAN AUTOMATIC FRONT OFFICE ROBOT MENGGUNAKAN IMPLEMENTASI COMPUTER VISION HAARLIKE FEATURE DAN FUZZY PROPORSIONAL DIFFERENTIAL PADA OS ANDROID3041BaruStatus usulan:1027078001UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:HENDRA ST, M.Sc.SISTEM INFORMASI GEOGRAFIS PENENTUAN RUTE TERPENDEK MENUJU TEMPAT PELAYANAN KESEHATAN DI KOTA BATAM MENGGUNAKAN METODE DIJKSTRA3042BaruStatus usulan:1021097101UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:ANDIK YULIANTOPengembangan Robot Jelajah Bawah Air Untuk Observasi Visual Terumbu Karang3043BaruStatus usulan:1023078101UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:ADI NEKA FATYANDRIPENGARUH DAN PERAN MANAJER SDM TERHADAP KEHARMONISAN HUBUNGAN INDUSTRIAL DI KOTA BATAM3044BaruStatus usulan:1004017702UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:YUDI KORNELISHarmonisasi Hukum Tentang Konsep Reorganisasi Dalam United States Bankruptcy Code Terhadap Ketentuan Penundaan Kewajiban Pembayaran Utang (PKPU) Dalam Hukum Kepailitan Indonesia Dengan Perspektif Budaya Hukum Indonesia3045BaruStatus usulan:1021087701UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:IMAN PURWOTO STMODEL PEMILIHAN MODA ANGKUTAN UMUM RAMAH PEREMPUAN (STUDI KASUS ANGKUTAN UMUM KOTA BATAM)3046BaruStatus usulan:1002027301UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:JOHNY BUDIMANAnalisis komparatif penerapan suku bunga KPR Bank di Batam3047BaruStatus usulan:1002027201UNIVERSITAS INTERNASIONAL BATAM101011Penelitian Dosen PemulaKode:381

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABILLY HENDRIK S.Kom., M.Kom.Pemanfaatan color card sebagai media komunikasi antara tuna wicara dengan mesin3048BaruStatus usulan:1018048301UNIVERSITAS PUTRA INDONESIA YPTK101012Penelitian Dosen PemulaKode:SUPRIYONOSELEKSI DIVERGEN PERFORMAN REPRODUKSI DAN DETEKSI POLIMORFISME GEN GH PADA PUYUH (Coturnix coturnix japonica) SELAMA DUA GENERASI UNTUK MENINGKATKAN POPULASI 3049BaruStatus usulan:1030066702Universitas Muara Bungo101016MP3EIKode:SETIONOKemampuan Adaptasi Empat Varietas Kacang Hijau Pada Pemberian Beberapa Dosis Dolomit di Tanah Masam Kabupaten Bungo3050BaruStatus usulan:1017087201Universitas Muara Bungo101016Penelitian Dosen PemulaKode:RINI HERTATI S.Pi, M.SiIDENTIFIKASI BIOFISIK PERAIRAN UNTUK PENGEMBANGAN BUDIDAYA PERIKANAN DI KABUPATEN BUNGO PROPINSI JAMBI3051BaruStatus usulan:1007097502Universitas Muara Bungo101016Penelitian Dosen PemulaKode:AKHYARNIS FEBRIALDIIdentifikasi dan Inventarisasi Tanaman obat yang digunakan Masyarakat di Hutan Kecamatan Bathin III Ulu Kabupaten Bungo3052BaruStatus usulan:1010028101Universitas Muara Bungo101016Penelitian Dosen PemulaKode:ISYATURRIYADHAHANALISIS FAKTOR-FAKTOR YANG MEMPENGARUHI MOTIVASI KERJA TENAGA HARIAN LEPAS TENAGA BANTUPENYULUH PERTANIAN DI KABUPATEN BUNGO 3053BaruStatus usulan:1017078302Universitas Muara Bungo101016Penelitian Dosen PemulaKode:NANIK ISTIANINGSIHKontribusi Pendapatan Petani Karet Terhadap Sektor Pertanian Di Kabupaten Bungo3054BaruStatus usulan:1024047702Universitas Muara Bungo101016Penelitian Dosen PemulaKode:MULIA JAYAPEMETAAN KONDISI AGRIBISNIS KAWASAN KOTA TERPADU MANDIRI KABUPATEN BUNGO3055BaruStatus usulan:1012018003Universitas Muara Bungo101016Penelitian Dosen PemulaKode:382

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMARWITA SARI PUTRIOPTIMALISASI PEMANFAATAN CANGKANG KERANG SIMPING (placuna placenta) DALAM PEMBUATAN BISKUIT3056BaruStatus usulan:1031038502Universitas Islam Indragiri101017Penelitian Dosen PemulaKode:NURSIDAMEMINIMALISIR PENGGUNAAN PUPUK KCl DENGAN SUBTITUSI PUPUK ORGANIK CAIR (POC) SABUT KELAPA DALAM MENINGKATKAN PERTUMBUHAN DAN PRODUKSI JAGUNG MANIS(Zea mays saccharata) DI TANAH GAMBUT3057BaruStatus usulan:1025047601Universitas Islam Indragiri101017Penelitian Dosen PemulaKode:YUSRIWARTIPENGARUH PENGALAMAN KERJA, INDEPENDENSI, KOMPETENSI, MOTIVASI DAN BATASAN WAKTU TERHADAP KUALITAS AUDIT (STUDY EMPIRIS PADA KAP WILAYAH JAMBI, PEKANBARU, BATAM)3058BaruStatus usulan:1026076801Universitas Islam Indragiri101017Penelitian Dosen PemulaKode:SYAIFUL RAMADHAN HARAHAPPENGARUH PEMBERIAN PAKAN ALAMI ALTERNATIF TERHADAP PERTUMBUHAN IKAN BETUTU (Oxyeleotris marmorata. Blkr.)DALAM KERAMBA JARING HAPA3059BaruStatus usulan:1013068302Universitas Islam Indragiri101017Penelitian Dosen PemulaKode:ABRAR RIDWAN MTOPTIMASI PEMANFAATAN PANAS BUANG TUNGKU GASIFIKASI BIOMASA SEBAGAI PENGHASIL LISTRIK3060BaruStatus usulan:1029097702Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:DEVVI SARWINDAPengembangan Sistem Manajemen dan Perolehan Dokumen Berbasis Clustering. Studi Kasus: Universitas Muhammadiyah Riau 3061BaruStatus usulan:1022078701Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:JUFRIZAL SYAHRI M. SiIsolasi, Karakterisasi, dan Uji Aktivitas Antikanker Senyawa Kimia dari Tumbuhan Tuba Aka (Derris sp), Tumbuhan Obat Suku Melayu Petalangan Provinsi Riau3062BaruStatus usulan:1002058501Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:FITRIANI MUTTAKINPERANCANGAN SEARCH ENGINE AUTOMATIC PLAGIARISM DETECTION UNTUK KEAMANAN PANGKALAN DATA ILMIAH DI LP2M UNIVERSITAS MUHAMMADIYAH RIAU 3063BaruStatus usulan:1012068601Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:383

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAPRASETYAPEMANFAATAN LIMBAH MINYAK BEKAS PENGGORENGAN UNTUK SINTESIS POLIURETAN (POLIMER SERBA BISA) BIODEGRADABLE 3064BaruStatus usulan:1009058701Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:ARYANTORancang Bangun Sistem Pemasaran Online UKM Kota Pekanbaru Untuk Evaluasi Dan Monitoring Hasil Produksi3065BaruStatus usulan:1028027301Universitas Muhammadiyah Riau101018Penelitian Dosen PemulaKode:ARMA YULIZA SE. M.SiAnalisis Pemahaman Terhadap SAK-ETAP Pada bank Perkreditan Rakyat Di Kota Pasir Pengaraian3066BaruStatus usulan:1030078402Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:DEFIDELWINAEFISIENSI TEKNIS PADI SAWAH DI KECAMATAN ROKAN IV KOTO3067BaruStatus usulan:1029098001Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:TONAAS KABUL WANGKOK YOHANIS MPENGARUH STRATEGI VAKSINASI KONTINU PADA MODEL EPIDEMIK SVIRS3068BaruStatus usulan:1003018103Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:PADA LUMBA S.T., M.TDAMPAK ON-STREET-PARKING TERHADAP BIAYA KEMACETAN PADA RUAS JALAN AHMAD YANI PEKANBARU - RIAU3069BaruStatus usulan:1027057201Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:HIDAYATKONTRIBUSI EXPERIENTIAL MARKETING STRATEGY PADA LOYALITAS PENGUNJUNG OBJEK WISATA-WISATA DI ROKAN HULU3070BaruStatus usulan:1027058601Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:UMMI RASYIDAHTHE EFFECTS OF CONCEPT MAPPING LEARNING STRATEGY ON CIVIL ENGINEERING STUDENTS’ IN ENGLISH READING COMPREHENSION3071BaruStatus usulan:1016118702Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:384

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANURUL AFIFAHPENGARUH MIND MAP TERHADAP PENGETAHUAN KOGNITIF MAHASISWA PENDIDIKAN BIOLOGI UNIVERSITAS PASIR PENGARAIAN3072BaruStatus usulan:1008098701Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:ARIF RAHMAN SALEH STPEMBUATAN SISTEM GASIFIKASI BIOMASSA PELEPAH KELAPA SAWIT PADA MESIN DIESEL 10 KW3073BaruStatus usulan:1021058502Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:ARRAFIQUR RAHMANPerilaku Spiritual dan Kepuasan Kerja Karyawan Perusahaan Pabrik Kelapa Sawit3074BaruStatus usulan:1018108502Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:KHAIRUL FAHMISOLUSI PENANGGULANGAN KECELAKAAN LALULINTASDI KABUPATEN ROKAN HULU3075BaruStatus usulan:1023087903Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:LEGISNAL HAKIM MT.RANCANG BANGUN KETEL UAP MINI DENGAN PENDEKATAN STANDAR SNI BERBAHANBAKAR CANGKANG SAWIT UNTUK KEBUTUHAN PABRIK TAHU KAPASITAS 200 KG KEDELAI/HARI3076BaruStatus usulan:1010107102Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:ELFENDRI ST., M.Eng.Kharakterisasi Serat Gulma pada Kebun Kelapa Sawit untuk Komposit Alam 3077BaruStatus usulan:1006067601Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:YULIANA SUSANTIINVENTARISASI GULMA PADA LAHAN PERKEBUNAN TANAMAN KELAPA SAWIT (Elaeis guineensis Jacq.) DI KECAMATAN TAMBUSAI UTARA KABUPATEN ROKAN HULU3078BaruStatus usulan:1027078103Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:ROFIZA YOLANDADIVERSITAS GASTROPODA (MOLUSKA) PADA EKOSISTEM MANGROVE DI PANTAI NIRWANA, PADANG, SUMATERA BARAT3079BaruStatus usulan:1011068503Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:385

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAALFI RAHMI M. EngEvaluasi Sistem Transportasi Sampah di Kabupaten Rokan Hulu3080BaruStatus usulan:1001018304Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:FILZA YULINA ADEAplikasi Bioteknologi dalam Pembuatan Nata de Coco sebagai Pembelajaran Life Skills Mahasiswa Semester V Prodi Pendidikan Biologi Universitas Pasir Pengaraian3081BaruStatus usulan:1021078601Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:Ir. EDWARD BAHAR M. PPEMANFAATAN MULSA ORGANIK KORAN PADA TANAMAN CABAI (Capsicum annumm L)3082BaruStatus usulan:1024066401Universitas Pasir Pangaraian101021Penelitian Dosen PemulaKode:MULYATI ST., MT.Pengaruh Penggunaan Limbah Beton Sebagai Agregat Kasar Dan Agregat Halus Terhadap Kuat Tekan Beton Normal3083BaruStatus usulan:1001047102INSTITUT TEKNOLOGI PADANG102002Penelitian Dosen PemulaKode:TRISNAHELDAKontribusi Sikap Bahasa dan Penguasaan Kalimat Efektif terhadap Keterampilan Menulis Wacana Argumentasi Mahasiswa Akademi Keperawatan Baiturrahmah Padang3084BaruStatus usulan:1030118103STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- MELDAWATI S.PdHeterogenitas Etnik di Pasaman Barat studi Kasus di Daerah Jambak3085BaruStatus usulan:1030118102STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- BUDI JULIARDI S.HPola Jaringan Sosial "Gepeng" di Kota Bukittinggi (Studi Penanggulangan Gepeng Melalui Pengembangan Jiwa Entrepreneur)3086BaruStatus usulan:1030078003STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- ELMIATI S.Pdevaluasi buku teks berjudul when english rings the bell untuk Sekolah Menegah Pertama Kelas VIIImplementasi kurikulum 20133087BaruStatus usulan:1029088301STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:386

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASALMAN ASSAHARY S.Ag, M.AgModel Penyadaran Sosial Masyarakat dalam Pengelolaan Sampah Berbasis Kearifan Budaya Lokal (Adat Basandi Syarak, Syarak Basandi Kitabullah) di Kota Padang3088BaruStatus usulan:1030047505STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:Dra INDRIANI NISJA M.PdPENINGKATAN KETERAMPILAN MENULIS PARAGRAF DEDUKTIF DAN INDUKTIF DENGGAN MENGGUNAKAN MODEL PEMBELAJARAN KOOPERATIF TIPE JIGSAW SISWA KELAS XI-KN PI MAN KOTO BARU PADANGPANJANG3089BaruStatus usulan:1027076701STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:SUMARNI S.Pd, M.PdUpaya Peningkatan Hasil Belajar IPS Siswa Melalui Metode Bermain Peran di Kelas VIII SMP Negeri 2 ulakan Tapakis Kabupaten Padang Pariaman3090BaruStatus usulan:1027078003STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- ANNA CESARIA S.PdANALISIS KEMAMPUAN MATEMATIS MAHASISWA STKIP PGRI SUMATERA BARAT DALAM PERKULIAHAN ENGLISH FOR MATHEMATICS DENGAN MENGGUNAKAN LEMBAR KERJA MAHASISWA (LKM) DISERTAI POWER POINT DAN TANPA POWER POINT3091BaruStatus usulan:1013038701STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- AGUSNI S.PdMembaca Puisi Dengan Menggunakan Strategi Choral Speaking Untuk Meningkatkan Pronounciation Siswa pada Kegiatan English Club Diprodi Bahasa Inggris STKIP SUMBAR3092BaruStatus usulan:1019087402STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- YULMIATI SSPengembangan Instrumen Penilaian Otentik pada Skill Membaca Teks Naratif untuk Pelajar Kelas I Semester I SMA di Kota Padang3093BaruStatus usulan:1021057702STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- REFNI YULIA SSPerubahan Pola Pemukiman Pasca Gempa 2009, Studi kasus: Pemukiman disekitar Areal By Pass Air Pacah, Kelurahan Sungai Sapih Padang3094BaruStatus usulan:1021048204STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- YUSUTRIA MAKEBERTAHANAN SURAU SYEIKH MATO AIE PAKANDANGAN KABUPATEN PADANG PARIAMAN DI TENGAH ARUSMODERNISASI PENDIDIKAN DAN KONTRIBUSINYA PADA MATAKULIAH PENDIDIKAN AGAMA ISLAM3095BaruStatus usulan:1020128204STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:387

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANEFILINDAImplementasi Kearifan Lokal Pengelolaan Sumberdaya Lahan dalam Pembangunan Ekonomi Masyarakat Kota Padang3096BaruStatus usulan:1020117102STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- MERINA PRATIWI S.SiPengembangan Modul Analisis Kompleks dengan Pendekatan Keterampilan Proses pada Program Studi Pendidikan Matematika di STKIP PGRI Sumatera Barat3097BaruStatus usulan:1020088601STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- RAHMA WIRA NITA S.Pd, KonsOptimalisasi Aktivitas Belajar Mahasiswa Melalui Terapi Rekonstruksi Kognitif dan Hypnolearning dalam Mata Kuliah Pelayanan BK di Sekolah Menengah Pada Program Studi Bimbingan dan Konseling STKIP PGRI Sumatera Barat3098BaruStatus usulan:1025058503STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- SESMIYANTI S.S, M.PdStrategi-Strategi Membaca Mahasiswa Jurusan Pendidikan Bahasa Inggris STKIP PGRI Sumatera Barat Tahun Akademik 2013/20143099BaruStatus usulan:1019098101STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:ZULFITRIYANIAnalisis Struktur Novel Laskar Pelangi dan Sang Pemimpi Karya Andrea Hirata (Kajian Intertekstual)3100BaruStatus usulan:1016088005STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- SURYA PRAHARA SHPARADOKS HUKUM DALAM PENYELESAIAN KONFLIK TANAH ULAYAT (Studi Sosiologi Hukum Tentang Sengketa Tanah Ulayat di Minangkabau)3101BaruStatus usulan:1022018602STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- FEBRI YANTI S.PdUji Efektivitas Media Compact Disc (CD) Interaktif Berbasis Karakter Pada Materi Sistem Peredaran Darah Manusia Untuk Siswa SMA3102BaruStatus usulan:1019028501STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- MERI ERAWATI SSSEKSUALITAS DALAM PARIWISATA: FENOMENA TENDA CEPER DI PANTAI PURUS PADANG SUMATERA BARAT3103BaruStatus usulan:1017098601STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:388

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- MELIYA WATI S.SiVariasi Ukuran Lambung dan Komposisi Makanan Rana cancrivora di Beberapa Lokasi berdasarkan ketinggian dan Lokasi Terisolasi secara Geografis di Sumatera Barat3104BaruStatus usulan:1017058501STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:SILVIA MARNIefektivitas metode sinektik dan minat membaca terhadap Keterampilan menulis esai populer mahasiswa angkatan 2012 program studi pendidikan bahasa dan sastra indonesia STKIP PGRI Sumatera Barat3105BaruStatus usulan:1017038501STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- VIVI FITRIANI S.SiAnalisis Mikroba pada kerang air tawar Contradens contradens di Danau Singkarak Kabupaten Solok Sumatera Barat 3106BaruStatus usulan:1025068303STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- SRI WAHYUNI S.Pd, M.PdPROSES PENETAPAN KRITERIA KETUNTASAN MINIMAL (KKM) PADA MATA PELAJARAN EKONOMI KELAS X DI SMA SEKECAMATANLUBUK KILANGAN KOTA PADANG3107BaruStatus usulan:1020058302STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- LILI PERPISA S.S, M.PdMeningkatkan Pemahaman Mahasiswa Terhadap Linguistik Pada Mata Kuliah Introduction to Linguistics Di Prog. Studi Pendidikan Bahasa Inggris STKIP PGRI SUMBAR3108BaruStatus usulan:1010018203STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- KAKSIM S.PdI, M.PdPERUBAHAN DARI TRADISI KE FESTIVAL SITI NURBAYA STUDI KASUS TRADISI MALAMANG DI KOTA PADANG3109BaruStatus usulan:1001098304STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- RINA WIDIANA S.Si, M.SiIDENTIFIKASI BIOKIMIA PADA iSOLAT BAKTERI PENGHASIL PENISILIN ASILASE DARI TANAH DI KOTA PADANG3110BaruStatus usulan:1006026801STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- FIRDAUS S.Sos, M.SiKONTESTASI RUANG EKONOMI KOTA:Studi Konflik Perebutan Ruang Ekonomi Antara Pemerintah Kota dengan Pedagang di Pasar Raya Padang3111BaruStatus usulan:1008098301STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:389

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- ADE IRMA SURYANI S.PdDegradasi Lahan Daerah Aliran Sungai Batang Kuranji Kota Padang 3112BaruStatus usulan:1001038202STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- MUHARDIS S.SPola Interferensi Fonologis Bahasa Indonesia dalam Karya Sastra Sebelum Kemerdekaan Karya Sastrawan Minang3113BaruStatus usulan:1006118202STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- DIANA SUSANTI S.PdUji Efektivitas Media Pembelajaran Interaktif Berorientasi Konstruktivisme pada Materi Neurulasi untuk Perkuliahan Perkembangan Hewan3114BaruStatus usulan:1028108502STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- YULIA SRI HARTATI S.S, M.PdAnalisis Soal Ujian Bahasa Indonesia Kelas XII di SMA Adabiah Padang3115BaruStatus usulan:1008087801STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- CITRA RAMAYNI S.PdFlypaper Effect Pada Dana Alokasi Umum (DAU) Dan Pendapatan Asli Daerah (PAD) Terhadap Belanja Daerah Pada Kabupaten/Kota di Provinsi Sumatera Barat 3116BaruStatus usulan:1010028401STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- LIRA HAYU AFDETISMANA S.Pd, M.PdKemamapuan Menyimak Berita Mahasiswa Program Studi Pendidikan Bahasa dan Sastra Indonesia STKIP PGRI Sumatra Barat dengan Menggunakan Media Audio3117BaruStatus usulan:1001048304STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- RIZKY NATASSIA SE, M.MPengaruh Ekspor Kakao Terhadap Pertumbuhan Ekonomi Sumbar3118BaruStatus usulan:1002098303STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:ALFAIZ S.Psi.I, M.PdPengaruh Observational Learning Terhadap Pembentukan Aspek Afektif Mahasiswa Program Studi Bimbingan dan Konseling (Studi PAda Mahasiswa STKIP PGRI Sumatera Barat)3119BaruStatus usulan:1001068802STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:390

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMA- SISKA S.SMenganalisa Masalah Retorik pada Hasil Tulisan Mahasiswa dalam Menulis Esai Diskusi Jurusan Bahasa Inggris STKIP PGRI Sumatera Barat3120BaruStatus usulan:1003088003STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:- RINEL FITLAYENI S.Sos, MAStrategi Organisasi dalam Menjaga Persistensi Pasar Tradisional (Studi Organisasi di Pasar Tradisional Kecamatan Padang Barat Kota Padang)3121BaruStatus usulan:1010128202STKIP PGRI SUMBAR103003Penelitian Dosen PemulaKode:NOVYTAPengembangan Lembar Kerja Mahasiswa pada Mata Kuliah Teori Bilangan untuk Mahasiswa Pendidikan Matematika STKIP-YDB Lubuk Alung3122BaruStatus usulan:1017088301STKIP YDB LUBUK ALUNG103004Penelitian Dosen PemulaKode:RENI NASTUTI S.Pd, M.SiPENGARUH PENERAPAN CONCEPT MAPPING UNTUK MENINGKATKAN AKTIVITAS DAN PEMAHAMAN KONSEP IPA TERPADU PADA SISWA SMPN DI KOTA PARIAMAN3123BaruStatus usulan:1019017902STKIP YDB LUBUK ALUNG103004Penelitian Dosen PemulaKode:YUSMALINDA M.PdThe Effect of Focused tasks toward Students' oral English Production3124BaruStatus usulan:1020127201SEKOLAH TINGGI BAHASA ASING PRAYOGA103013Penelitian Dosen PemulaKode:HAYATUL MUGHIROHEksperimentasi Model Pembelajaran Problem based Learning Terhadap Kemampuan Pemecahan Masalah pad Mahasiswa Pendidikan Matematika Ditinjau dari Kemandirian Belajar3125BaruStatus usulan:1010108002STKIP YPM BANGKO103020Penelitian Dosen PemulaKode:ROZANA ZUHRIANALISIS KUALITAS AIR MINUM ISI ULANG (AMIU) DI BANGKO KABUPATEN MERANGIN 3126BaruStatus usulan:1021098702STKIP YPM BANGKO103020Penelitian Dosen PemulaKode:ELMAIDAThe Effect of Vocabulary Self-Collection Strategy Toward Students' Vocabulary Mastery at Fifth Semester of STKIP YPM Bangko in the Academic Year of 2013/20143127BaruStatus usulan:1004058601STKIP YPM BANGKO103020Penelitian Dosen PemulaKode:391

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHERU AULIA AZMAN S.Sos, MMANALISIS PENGARUH SEKTOR PARIWISATA TERHADAP PEREKONOMIAN DAERAH PROVINSI SUMATERA BARAT3128BaruStatus usulan:0009127701SEKOLAH TINGGI ILMU EKONOMI DHARMA ANDALAS103025Penelitian Dosen PemulaKode:EZIZWITAANALISIS FAKTOR-FAKTOR INTERNAL DAN EKSTERNAL PENYALURAN KREDIT MIKRO NAGARIDI KOTA PADANG3129BaruStatus usulan:1011036101SEKOLAH TINGGI ILMU EKONOMI DHARMA ANDALAS103025Penelitian Dosen PemulaKode:YUNITA VALENTINA KUSUFIYAHRELEVANSI KOMPONEN-KOMPONEN INTELLLECTUAL CAPITAL TERHADAP HARGA SAHAM DENGAN UKURAN PERUSAHAAN DAN KINERJA KEUANGAN PERUSAHAAN SEBAGAI VARIABEL MODERATING3130BaruStatus usulan:1010068303SEKOLAH TINGGI ILMU EKONOMI DHARMA ANDALAS103025Penelitian Dosen PemulaKode:- REVI YENTI M.Si,AptFormulasi Lipstik Menggunakan Zat Warna Alami dari Ekstrak Bunga Pacar Air (Impatiens balsamina Linn)3131BaruStatus usulan:0403027601SEKOLAH TINGGI FARMASI INDONESIA PERINTIS PADANG103033Penelitian Dosen PemulaKode:RIA AFRIANTI M.Farm., Apt.Pengembangan Minyak Atsiri Bunga Tanjung (Mimusops elengi) dan Minyak Atsiri Bunga Kamboja (Plumeria acuminata) Sebagai Obat Antidepresan dan Potensinya Sebagai Produk sediaan Farmasi3132BaruStatus usulan:1005048101SEKOLAH TINGGI FARMASI INDONESIA PERINTIS PADANG103033Penelitian Dosen PemulaKode:MIMI ARIA S.Farm,AptPemanfaatan Lidah Buaya (Aloe vera) Untuk Penanganan Penyakit Diabetes dengan Komplikasi Hiperkolesterol Pada Mencit3133BaruStatus usulan:1001078201SEKOLAH TINGGI FARMASI INDONESIA PERINTIS PADANG103033Penelitian Dosen PemulaKode:MUHAMMAD FIKRYPEMBUATAN SOFTWARE SISTEM PAKAR UNTUK IDENTIFIKASI HAMA PENYAKIT TANAMAN CABE3134BaruStatus usulan:1031108702STMIK INDONESIA103054Penelitian Dosen PemulaKode:ZAINUL EFENDYAplikasi Evaluasi Kinerja Dosen Pada Perguruan Tinggi Berbasis Teknologi Informasi3135BaruStatus usulan:1030127602STMIK INDONESIA103054Penelitian Dosen PemulaKode:392

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAGUSRINO YANTOPembudidayaan Lele yang lebih efektif berbasiskan teknologi informasi menggunakan Decision Support System (DSS) dengan Metode Analytical Hierarchy Process3136BaruStatus usulan:0101088502STMIK INDONESIA103054Penelitian Dosen PemulaKode:RUSDISAL RUSMI S.Pd, M.Si.Aplikasi Penjamin Mutu SDM Pada Perguruan Tinggi3137BaruStatus usulan:0027116904STMIK INDONESIA103054Penelitian Dosen PemulaKode:IR. MUHAMMAD AMRI LUBIS M.SCSISTEM INFORMASI MONITORING PENDAPATAN PARKIR KOTA PADANG MENGGUNAKAN TELEPON SELULER3138BaruStatus usulan:0020096608STMIK INDONESIA103054Penelitian Dosen PemulaKode:ILHAM EKA PUTRAPemanfaatan Teknologi Komunikasi Visual Interaktif Dalam Pembuatan Aplikasi Informasi Promosi Kampus Berbasis Multimedia 3139BaruStatus usulan:1021038201STMIK INDONESIA103054Penelitian Dosen PemulaKode:Drs. RAJAB M.Pd.Pembagain Harta Warisan di Minangkabau Berdasarkan Perspektif Islam Berbasis Teknologi Informasi3140BaruStatus usulan:1012096601STMIK INDONESIA103054Penelitian Dosen PemulaKode:IMAM GUNAWAN S.Kom, M.KomMembangun Sistem Informasi Kegiatan Pesantren Ramadhan Berbasis Web Sebagai Upaya Untuk Optimalisasi Pelaksanaan Pesantren Ramadhan Pelajar Se-Kota Padang3141BaruStatus usulan:1026037701STMIK JAYA NUSA103057Penelitian Dosen PemulaKode:ALHAMIDIMembangun Sistem Pakar Pendeteksi Penyakit Tanaman Buah Tropika Dengan Metode Forward Chaining3142BaruStatus usulan:1018057901STMIK JAYA NUSA103057Penelitian Dosen PemulaKode:ARMON FERNANDO M.Si,AptVALIDASI METODE PENETAPAN KADAR BORAKS MENGGUNAKAN PEREAKSI DIETILDITIOKARBAMAT DALAM SAMPEL MAKANAN SECARA KROMATOGRAFI CAIR KINERJA TINGGI3143BaruStatus usulan:1015038003SEKOLAH TINGGI ILMU FARMASI RIAU103058Penelitian Dosen PemulaKode:393

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARAHAYU UTAMI S M.Farm,AptUji aktivitas antidiabetes dari ekstrak dan fraksi akar dan batang sekunyit (Fibraurea tinctoria Lour)terhadap mencit putih jantan (Mus musculus) 3144BaruStatus usulan:1023038401SEKOLAH TINGGI ILMU FARMASI RIAU103058Penelitian Dosen PemulaKode:- DENI AGGRAINI M.Farm,AptFORMULASI DAN UJI AKTIVITAS ANTIOKSIDAN MASKER GEL EKSTRAK ETANOL DAUN JAMBU METE (Anacardium occidentale Linn)3145BaruStatus usulan:1004127602SEKOLAH TINGGI ILMU FARMASI RIAU103058Penelitian Dosen PemulaKode:- ENDA MORA M.Farm,AptIsolasi dan Karakterisasi senyawa Metabolit Sekunder Ekstraks Etil asetat Kulit batang Meranti rambai (Shorea acuminata Dyer)3146BaruStatus usulan:1006116701SEKOLAH TINGGI ILMU FARMASI RIAU103058Penelitian Dosen PemulaKode:RIKA ANDRIYANIFaktor Risiko Yang Berhubungan Dengan Kejadian Infeksi Toksoplasma pada Ibu Hamil di RSUD Arifin Achmad Pekanbaru Tahun 2013 3147BaruStatus usulan:1005118503SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:HERLINA SUSMANELI M. KesANALISIS HUBUNGAN PERILAKU REMAJA TENTANG EPIDEMIOLOGI KESEHATAN REPRODUKSI DI SMA NEGERI KOTA PEKANBARU3148BaruStatus usulan:1006028503SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:NURVI SUSANTI SKM, M. KesFaktor-Faktor yang Berhubungan dengan Kejadian Pneumonia Balita di Wilayah Kerja Puskemas Rumbai Kecamatan Rumbai Pesisir Kota Pekanbaru Tahun 20143149BaruStatus usulan:1018018302SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:OCTA DWIENDA RISTICAPENGARUH KEIKUTSERTAAN SENAM HAMIL DALAM MENURUNKAN KECEMASAN MENGHADAPI PERSALINAN PRIMIGRAVIDA DI PUSKESMAS KOTA PEKANBARU3150BaruStatus usulan:1008108502SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:NOVITA LUSIANA SARMINFaktor-faktor yang berhubungan dengan kegagalan ibu dalam pemberian Asi Esklusif di wilayah kerja Puskesmas Melur Kota Pekanbaru tahun 20143151BaruStatus usulan:1017118501SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:394

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANURLISISPemakaian Metode Kontrasepsi Jangka Panjang (MKJP) di Kecamatan Rumbai Pesisir Pekanbaru3152BaruStatus usulan:1004078402SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH103061Penelitian Dosen PemulaKode:REFIKA KOMALAPengaruh Pemberian Konsentrasi Getah Buah Pepaya terhadap Komposisi Kimia dan Organoleptik Dadih kerbau 3153BaruStatus usulan:1031127902STIPER SAWAHLUNTO SIJUNJUNG103063Penelitian Dosen PemulaKode:AFRINI DONAPeningkatan Produksi dan Kualitas Paspalum dilatatum dengan Pemberian Pupuk Kompos berbagai Kotoran Ternak yang ditambah dengan Bahan Pemicu Organisme3154BaruStatus usulan:1030068303STIPER SAWAHLUNTO SIJUNJUNG103063Penelitian Dosen PemulaKode:HERA DWI TRIANIPemanfaatan Limbah Kulit Singkong dalam Ransum Itik Kamang sebagai Plasma Nutfah Sumatera Barat3155BaruStatus usulan:0023017804STIPER SAWAHLUNTO SIJUNJUNG103063Penelitian Dosen PemulaKode:NELDASWENTIAnalisis Capaian Swasembada Daging Sapi Tahun 2014 di Provinsi Sumatera Barat3156BaruStatus usulan:1011096501STIPER SAWAHLUNTO SIJUNJUNG103063Penelitian Dosen PemulaKode:HERNI YULITAPENGARUH PEMBERIAN PENYULUHAN KESEHATAN TENTANG HAID PERTAMA (MENARCHE) TERHADAP KECEMASAN MENGHADAPI HAID PERTAMA (MENARCHE) PADA ANAK USIA 10-12 TAHUN DI SD N 63 SURABAYO LUBUK BASUNG KABUPATEN AGAM 3157BaruStatus usulan:1024048801SEKOLAH TINGGI ILMU KESEHATAN CERIA BUANA103064Penelitian Dosen PemulaKode:FISKA RINAHubungan Pengetahuan Ibu Hamil Tentang tablet FeDengan Kejadian Anemia di Jorong Koto Malintang Wilayah Kerja Puskesmas Pakan kamih Kabupaten Agam Tahun 20143158BaruStatus usulan:1027028303SEKOLAH TINGGI ILMU KESEHATAN CERIA BUANA103064Penelitian Dosen PemulaKode:JOHAN S. Kom, M. KomRancang Bangun Sistem Informasi Perawatan PasienPantirehabilitasi Beban Mental Dan Narkoba Menggunakan Bahasa Pemrograman Berorientasi Objek Pada Rumah Sakit Jiwa Tampan Pekanbaru3159BaruStatus usulan:1017038601SEKOLAH TINGGI ILMU KOMPUTER PELITA INDONESIA103070Penelitian Dosen PemulaKode:395

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAYENNI M.Kep.,Ns.Sp.Kep.KomPERBEDAAN TEKANAN DARAH LANSIA HIPERTENSI PRIMER SEBELUM DAN SESUDAH PROGRESSIVE MUSCLE RELAXATION DI WILAYAH KERJA PUSKESMAS PERKOTAAN BUKITTINGGI3160BaruStatus usulan:0012057601Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:EFRIZA SKM, MKMANALISIS FAKTOR RESIKO EPIDEMIOLOGIS KASUS HIV/AIDS DI KOTA BUKITTINGGI TAHUN 20133161BaruStatus usulan:0028047215Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:CICI APRIZA YANTI SKMBENTUK PENULARAN DBD DI KOTA BUKITTINGGI (Analisis Faktor Lingkungan Dan Perilaku) TAHUN 20133162BaruStatus usulan:1006048302Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:DETTY AFRIYANTI S SSTHUBUNGAN STATUS GIZI DAN ANEMIA PADA IBU HAMIL DENGAN KEJADIAN LAHIR MATI DI KABUPATEN AGAMTAHUN 20133163BaruStatus usulan:1014048103Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:Ns ARIA WAHYUNI M.Kep., Ns.Sp.Kep.M.BEfektifitas Edukasi Kesehatan Terstruktur Terhadap Pemberdayaan dan Efikasi Diri Pasien Penyakit Jantung Koroner Di Rumah Sakit Kota Bukittinggi3164BaruStatus usulan:1016058301Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:Ns WENNY LAZDIA S.KepEFEKTIFITAS AROMATERAPI LAVENDER DAN TERAPI MUSIK TERHADAP KUALITAS TIDUR LANSIA DI PSTW KASIH SAYANG IBU BATU SANGKAR TAHUN 20133165BaruStatus usulan:1009028402Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:Ns YELMI RENI PUTRI S.KepHUBUNGAN KEPATUHAN PASIEN ODHA MEMINUM OBAT DENGAN KEBERHASILAN TERAPI ANTIRETROVIRAL ( ARV ) DI RUANG RAWAT JALAN RSUD ACHMAD MUCHTAR BUKITTINGGI 20143166BaruStatus usulan:1001068001Sekolah Tinggi Ilmu Kesehatan Fort De Kock103073Penelitian Dosen PemulaKode:ARIFA RAHMIPeningkatan Kualitas Hidup Melalui Pendekatan Pengalaman, Budaya, dan Kebutuhan, pada Wanita masa klimakterium3167BaruStatus usulan:1013118001SEKOLAH TINGGI ILMU KESEHATAN BAITURRAHIM103077Penelitian Dosen PemulaKode:396

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMATINA YULI FATMAWATIKecenderungan Pengunaan Napza Pada Remaja SMA N di Kota Jambi3168BaruStatus usulan:1002057501SEKOLAH TINGGI ILMU KESEHATAN BAITURRAHIM103077Penelitian Dosen PemulaKode:ANDI PUTRAPEMBANGUNAN MODUL MULTIMEDIA INTERAKTIF UNTUK PEMBELAJARAN ADOBE PHOTOSHOP 3169BaruStatus usulan:1007028502SEKOLAH TINGGI TEKNOLOGI PAYAKUMBUH103080Penelitian Dosen PemulaKode:ROSDA SYELLYPERANCANGAN MEDIA PEMBELAJARAN BERBASISKAN E-LEARNING UNTUK MENUJU STUDENT CENTERED E-LEARNING ENVIRONMENT3170BaruStatus usulan:1010128201SEKOLAH TINGGI TEKNOLOGI PAYAKUMBUH103080Penelitian Dosen PemulaKode:MARIA DONA OCTAVIAKarakterisasi Kompleks Inklusi Simvastatin - β-Siklodekstrin yang dibuat dengan Metoda Kneading3171BaruStatus usulan:1010108101SEKOLAH TINGGI ILMU FARMASI PADANG103081Penelitian Dosen PemulaKode:ELISMAKajian Efek Antiaterosklerosis Ekstrak Daun Gaharu (Aquilaria malaccensis Lamk) pada Burung Puyuh3172BaruStatus usulan:1021108501SEKOLAH TINGGI ILMU FARMASI PADANG103081Penelitian Dosen PemulaKode:ELMIYASNA K S.Kp, M.MPengaruh Pemberian air rebusan daun kumis kucing (Orthosiphon aristatus) terhadap penurunan kadar gula darah pasien DM Tipe II di Poliklinik Khusus Endokrin RSUP Dr. M Djamil Padang3173BaruStatus usulan:0028085409STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:AIDA MINROPAFaktor-Faktor Yang Mempengaruhi Kemajuan Terapi Anak Autis di Kota Padang Tahun 20133174BaruStatus usulan:1004077401STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:ZULFITAFaktor-faktor yang berhubungan dengan kejadian perdarahan pasca persalinan di BPM wilayah kerja Puskesmas Nanggalo Padang tahun 20143175BaruStatus usulan:1023067401STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:397

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAGINA MUTHIAImplementasi Program Gerakan Sayang Ibu (GSI)dalam Upaya Menurunkan Angka Kematian Ibu di Wilayah Kerja Puskesmas Naras Pariaman 3176BaruStatus usulan:1004018401STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:PUTRI NELLY SYOFIAHEFEKTIVITAS SUPLEMENTASI FE DAN ASAM FOLAT TERHADAP PENINGKATAN KADAR HAEMOGLOBIN IBU HAMIL YANG MENDERITA ANEMIA DI KOTA PADANG 3177BaruStatus usulan:1003028401STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:Ns ZULHAM EFENDI S.KepPengaruh Pemberian Jus Pare (Momordica Carantial) Terhadap Penurunan Gula Darah Pada Penderita Diabetes Mellitus Diwilayah Kerja Puskesmas Nanggalo Tahun 2013.3178BaruStatus usulan:1018028301STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:Ns DEDI ADHA S.KepPengaruh Pemberian Air Perasan Daun Pepaya (Carica Papaya) Terhadap Penurunan Intensitas Nyeri Menstruasi (Dismenore) Pada Mahasiswi Angkatan 2012 Prodi SI Keperawatan Stikes Mercubaktijaya Padang3179BaruStatus usulan:1013127401STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:WIDYA LESTARIhubungan karakteristik dan peran kader dalam deteksi dini risiko kehamilan di wilayah kerja puskesmas Nanggalo Padang3180BaruStatus usulan:1007098301STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:ETRI YANTI S.Kp, M.BiomedEFEKTIFITAS DAUN SIRIH MERAH (PIPER CROCATUM) TERHADAP PENYEMBUHAN KEPUTIHAN PADA WANITA USIA SUBUR (WUS) DI KELURAHAN SURAU GADANG WILAYAH KERJA PUSKESMAS NANGGALO PADANG 3181BaruStatus usulan:1001017202STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:Ns. GUSLINDA R M.Kep., Sp.Kep.JPengaruh pemberian logoterapi terhadap penurunan kecemasan pada lansia di Kelurahan Kurao Pagang Padang3182BaruStatus usulan:1006087202STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:ETY APRIANTIFaktor-Faktor Yang Berhubungan Dengan Penderita Penyakit Menular Seksual di RSUP Dr. M.Djamil Padang3183BaruStatus usulan:1028047501STIKES MERCU BAKTI JAYA PADANG103082Penelitian Dosen PemulaKode:398

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAALINIFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEPATUHAN KELUARGA MEMBAWA PULANG PENDERITA SKIZOFRENIA PASCA DIRAWAT DI RUMAH SAKIT JIWA TAMPAN PROVINSI RIAU 3184BaruStatus usulan:1030088002STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:MUHAMMAD NURMANEfektifitas Kompres Hangat terhadap Penurunan Suhu Tubuh pasien Demam (febris)di Ruang Rawat Inap Interne RSUD Bangkinang3185BaruStatus usulan:1031127701STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:YUSNIRA M.SiPengaruh minyak jintan hitam (Nigela sativa) terhadap profil lipid serum tikus jantan galur wistar (Rattus Norvegicus)hiperkolesterolemia3186BaruStatus usulan:0404037302STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:MASRULUSING INFORMATION GAP TO IMPROVE THE SPEAKING SKILL AT SECOND SEMESTER OF NUTRTION DEPARTMENT STUDENTS OF STIKes TUANKU TAMBUSAI RIAU3187BaruStatus usulan:1005048402STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:MUHAMMAD NIZAR SYARIF HAMIDIFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN DBD DI KABUPATEN KAMPAR PROVINSI RIAU TAHUN 20133188BaruStatus usulan:1027037301STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:YENNY SAFITRIEfektivitas Pelatihan Metoda Konseling Terhadap Kemampuan Manajer Mengelola Perawat Berkebutuhan Khusus Di Rumah Sakit Islam Ibnu Sina Bangkinang3189BaruStatus usulan:1002088201STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:NUR AFRINISPeran Serta Kader Posyandu dalam Upaya Peningkatan Status Gizi Balita di Kabupaten Kampar Riau3190BaruStatus usulan:1004048401STIKES TUANKU TAMBUSAI103083Penelitian Dosen PemulaKode:SURAINI M. SiUJI AKTIFITAS ANTIJAMUR EKSTRAK GAMBIR ((Uncaria Gambir Roxb) TERHADAP Candida Albicans SECARA IN VITRO3191BaruStatus usulan:1020116503STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:399

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMADYNA PUTRI MAYASERLIEFEKTIFITAS BAKTERI PSEUDOMONAS FLUORESCENS SEBAGAI PENYERAP LOGAM Cd PADA LEACHATE TPA AIR DINGIN3192BaruStatus usulan:1022058701STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:WILDA LAILAFaktor Risiko Kejadian "Stunting" pada Anak Balita Usia 24-59 bulan di Kota Padang3193BaruStatus usulan:1017108302STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:SEPNI ASMIRA S.T.P, MPPENGARUH PENGGUNAAN JAMBU BIJI MERAH DENGAN KONSENTRASI YANG BERBEDA TERHADAP MUTU ORGANOLEPTIK DAN KADAR VITAMIN C TERHADAP DODOL RUMPUT LAUT 3194BaruStatus usulan:1024097801STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:VERA SESRIANTYEfektifitas Hipnoterapy terhadap Peningkatan Muskular Strenght pada Pasien Stroke dengan Hemiparese di Ruangan Neurologi RS Stroke Nasional Bukittinggi3195BaruStatus usulan:1002117801STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:DEWI YUDIANA SHINTA M. Si. A.ptPemanfaatan Limbah Kulit Buah Naga(Hylocareus costaricensis)Sebagai Penurun Glukosa Darah Pada Mencit Jantan Putih3196BaruStatus usulan:1016017602STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:ERAWATIEfektifitas Ekstrak Kulit (Pericarp) Buah Manggis (Garcinia mangostana L) terhadap Pertumbuhan Candida albicans3197BaruStatus usulan:1005097402STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:CORRY HANDAYANIPEMANFAATAN KULIT PISANG (Musa Paradisiaca) UNTUK MENINGKATKAN KUALITAS MINYAK JELANTAH 3198BaruStatus usulan:1006018701STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:ALYA MISDHAL RINIHubungan Pemberian ASI Ekslusif dan Tingkat Pengetahuan Ibu dengan Status Gizi Bayi Usia 7 - 12 Bulan di Puskesmas Lubuk Buaya Padang Tahun 20143199BaruStatus usulan:1017067602STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:400

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARINDA LESTARI S.PdKontribusi Komunikasi Interpersonal dan Gaya Kepemimpinan Ketua STIKes terhadap Motivasi Kerja Dosen di Kota Padang3200BaruStatus usulan:1012037604STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:YASLINAPengaruh Pemberian Pendidikan Kesehatan Melalui Nursing Home Terhadap Kemampuan Keluarga Di Rumah Dalam Perawatan Pasca Stroke Di Kota Bukittinggi3201BaruStatus usulan:1006037301STIKES PERINTIS PADANG103084Penelitian Dosen PemulaKode:CANDRA SAPUTRAAnalisa Peran Kader Kesehatan terhadap Kemajuan Revitalisai Posyandu di Wilayah Kerja Puskesmas Rumbai Kecamatan Rumbai Kota Pekabaru3202BaruStatus usulan:1021068602Sekolah Tinggi Ilmu Kesehatan Payung Negeri103096Penelitian Dosen PemulaKode:GUNAWAN ALI M.KomPENERAPAN METODE PREFERENCE RANKING ORGANIZATION METHOD FOR ENRICHMEN EVALUATION (PROMETHEE) DALAM ANALISIS MULTI CRITERION DECISION MAKING (MCDM)UNTUK PEMILIHAN KARYAWAN BERPRESTASI PADA STIKES DHARMASRAYA KABUPATEN DHARMASRAYA3203BaruStatus usulan:1014028501STMIK Dharmasraya103097Penelitian Dosen PemulaKode:EPRI YULDISistem Informasi Geografis Sarana dan Prasarana Kesehatan Kabupaten Dharmasraya Berbasis Web dengan Metode UML3204BaruStatus usulan:1006078901STMIK Dharmasraya103097Penelitian Dosen PemulaKode:FIRMANSYAH PUTRAPERANCANGAN SISTEM INFORMASI PENDATAAN PENDUDUK BERBASIS GUI (GRAPHICAL USER INTERFACE) PADA KENAGARIAN GUNUNG MEDAN KABUPATEN DHARMASRAYA3205BaruStatus usulan:1014038402STMIK Dharmasraya103097Penelitian Dosen PemulaKode:FITRA KASMA PUTRA S.KOM M.KOMPENGUJIAN SISTEM PAKAR DENGAN MENGGUNAKAN METODE EXPERIENTAL LEARNING DALAM MENENTUKAN GAYA BELAJAR SISWA TERHADAP PEMILIHAN JURUSAN PADA SMK N 1 PULAU PUNJUNG KABUPATEN DHARMASRAYA3206BaruStatus usulan:1007028501STMIK Dharmasraya103097Penelitian Dosen PemulaKode:ANNERUFARIDAH M.BiomedPengaruh paparan asap rokok pada ibu hamil terhadap bayi baru lahir dikota Padang tahun 20133207BaruStatus usulan:1025088301STIKES Ranah Minang103104Penelitian Dosen PemulaKode:401

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAJUARSA BADRI SE, MMTINGKAT KEPUASAN MASYARAKAT TERHADAP PELAYANAN PUSKESMAS DI KABUPATEN SOLOK3208BaruStatus usulan:1023086901Sekolah Tinggi Ilmu Ekonomi El Hakim103106Penelitian Dosen PemulaKode:DONA AMELIA SEFAKTOR FAKTOR YANG MEMPENGARUHI IMPLEMENTASI HAK KEKAYAAN INTELEKTUAL (HAK CIPTA DAN MEREK) PADA UKM DI KABUPATEN AGAM3209BaruStatus usulan:1016057802Sekolah Tinggi Ilmu Ekonomi El Hakim103106Penelitian Dosen PemulaKode:LINDA HANDAYUNI M.SiAnalisis Mutu Pelayanan Rekam Medis Rawat Jalan Menurut Persepsi Pasien diRSUD Arosuka Tahun 20133210BaruStatus usulan:1029098005STIKES Dharma Landbouw103110Penelitian Dosen PemulaKode:Ns DENI MAISA PUTRA S.KepPengaruh Sari Pati (Air) Kunyit Untuk Penurunan KadarAsam Lambung Pada Penderita Gastritis Di Jorong Tanjung Alai Kabupaten Agam.3211BaruStatus usulan:1025058507STIKES Dharma Landbouw103110Penelitian Dosen PemulaKode:OKTAMIANIZA M.KESAnalisis Penerapan CaseMix INA-CBGs berdasarkan Kelengkapan dan Ketepatan Kode Diagnosis Penyakit dan Tindakan pada Beberapa Rumah Sakit Umum Daerah di Propinsi Sumatera Barat tahun 20143212BaruStatus usulan:1006088001STIKES Dharma Landbouw103110Penelitian Dosen PemulaKode:HENDRA NUSA PUTRA S.KomANALISIS PEMANFAATAN KOMPUTER TERHADAP KEGIATANPENGOLAHAN BERKAS REKAM MEDIS DI RSUD DR. ADNAANWD PAYAKUMBUH3213BaruStatus usulan:1007128402STIKES Dharma Landbouw103110Penelitian Dosen PemulaKode:DR. PRAMUDJO ABDULGANI, Sp.JPFAKTOR-FAKTOR YANG MEMPENGARUHI RENDAHNYA DETEKSI DINI KANKER SERVIKS DI WILAYAH KOTA PEKANBARU 3214BaruStatus usulan:1021105102STIKES Pekanbaru Medical Center103116Penelitian Dosen PemulaKode:ELIZA SPd., S.KepPENGARUH TERAPI MUSIK MOZART TERHADAP PENURUNAN DERAJAT NYERI MENSTRUASI PADA REMAJA PUTRI DI SMK SINTUK TOBOH GADANG 3215BaruStatus usulan:1030067201STIKES Nan Tongga103120Penelitian Dosen PemulaKode:402


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAEVI SUSANTI S.ST., M.BIOMEDAnalisis kualitas air minum pada depot air minum isi Ulang ditinjau dari proses ozonisasi ultraviolet dan reversed osmosis di Kota Bukittinggi3224BaruStatus usulan:1008087301STIKES Prima Nusantara103121Penelitian Dosen PemulaKode:MIGUSNAWATIFormulasi Azolla, Limbah Kulit Singkong dan Limbah Batang Pisang (AKSIBPA) Sebagai Pupuk Organik Plus3225BaruStatus usulan:1030088003Sekolah Tinggi Pertanian Haji Agus Salim103126Penelitian Dosen PemulaKode:KIKI AMELIAPengaruh MOL Isi Rumen dan Level Tithonia diversifolia dalam Peningkatan Daya Guna Limbah Jamur Tiram Menjadi Kompos Plus3226BaruStatus usulan:1005038502Sekolah Tinggi Pertanian Haji Agus Salim103126Penelitian Dosen PemulaKode:PUTRI RIZKI UTAMIOPTIMASI PENGOMPOSAN SAMPAH ORGANIK RUMAH TANGGA DENGAN BERBAGAI WAKTU FERMENTASI UNTUK PERBAIKAN pH DAN AL-DD ULTISOL3227BaruStatus usulan:1004118602Sekolah Tinggi Pertanian Haji Agus Salim103126Penelitian Dosen PemulaKode:YURMA METRI S.Pt, MPFORMULASI PAKAN TERNAK DENGAN FERMENTASI AZOLLA, KULIT SINGKONG DAN BONGGOL PISANG 3228BaruStatus usulan:1025017102Sekolah Tinggi Pertanian Haji Agus Salim103126Penelitian Dosen PemulaKode:NIDYA FITRIEvaluasi Implementasi Kurikulum Tingkat Satuan Pendidikan Sekolah Dasar Di Kabupaten Dharmasraya3229BaruStatus usulan:1026068505STKIP Dharmasraya103128Penelitian Dosen PemulaKode:MUHAMMAD SUBHANPENGEMBANGAN SUBJECT, SPECIFIC, PEDAGOGY (SSP) IPA KURIKULUM 2013 UNTUK MENGEMBANGKAN SCIENCE PROCESS SKILLS (SPS) SISWA SD KELAS IV3230BaruStatus usulan:1015128701STKIP Dharmasraya103128Penelitian Dosen PemulaKode:MOH ROSYID MAHMUDISOLUSI ANALITIK PERSAMAAN SCROEDINGER ATOM BERELEKTRON TUNGGAL He¬- dan Li-2 MENGGUNAKAN METODE ALGEBRAIC COMPUTATION3231BaruStatus usulan:1006108701STKIP Dharmasraya103128Penelitian Dosen PemulaKode:404

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARAHMATUL HAYATIPengaruh Penerapan Empat Prinsip Komunikasi Ampuh dalam Quantum Teaching terhadap Motivasi Belajar Matematika Siswa Kelas VIII SMP Negeri 1 Pantai Cermin Kab. Solok3232BaruStatus usulan:1020128601STKIP Dharmasraya103128Penelitian Dosen PemulaKode:RINI ASMARAPendekatan Work Sistem Framework untuk Knowledge Sharing Dalam Proses Learning Organization Guna Mengantisipasi Kompleksitas Situasi Sebagai Upaya Peningkatan Kompetensi Lulusan3233BaruStatus usulan:1020067501Akademi Manajemen Informatika & Komputer Jaya Nusa104030Penelitian Dosen PemulaKode:HAYATUL ISLAMIINTEGRASI SISTEM PENUNJANG KEPUTUSAN DALAM SISTEM PENYALURAN ZAKAT BEASISWA DHUAFA PADA LEMBAGA PKPU PADANG DALAM UPAYA PENINGKATAN PEMERATAAN AKSES PENDIDIKAN BAGI MASYARAKAT MISKIN DAN MASYARAKAT TERPENCIL3234BaruStatus usulan:1027088601Akademi Manajemen Informatika & Komputer Jaya Nusa104030Penelitian Dosen PemulaKode:ISNARDI S.Kom, M.KomImplementasi mobile Learning berbasis Android dalam Membangun Masyarakat Cerdas Bencana 3235BaruStatus usulan:1006077001Akademi Manajemen Informatika & Komputer Jaya Nusa104030Penelitian Dosen PemulaKode:ZULFISAFormulasi Gel Repellent Ekstrak Etanol Daun Kembang Bulan (Tithonia diversifolia (Hemsley)A. Gray).3236BaruStatus usulan:1024126401AKADEMI FARMASI DW I FRAMA104047Penelitian Dosen PemulaKode:MUHAMMAD RIZA MARJONIPemurnian Etanol Hasil Fermentasi Kulit Umbi Singkong (Manihot utilissima Pohl) Dari Limbah Industri Kerupuk Sanjai Di Kota Bukittinggi Berdasarkan Suhu dan Waktu Destilasi3237BaruStatus usulan:1006037702AKADEMI FARMASI DW I FRAMA104047Penelitian Dosen PemulaKode:AINUN NAIMPENENTUAN AKTIVITAS ANTIOKSIDAN DAN FENOLIK TOTAL PADA TUMBUHAN MATOA (Pometia pinnata)3238BaruStatus usulan:1010015601AKADEMI FARMASI DW I FRAMA104047Penelitian Dosen PemulaKode:Ns HENDRAWATI S.Kep, M.BiomedSTUDI PERBANDINGAN PENATALAKSANAAN TERAPI DENGAN DAN TANPA DIET CASEIN FREE GLUTEN FREE (DIET CFGF) TERHADAP KEMAJUAN ANAK AUTISME DI SEKOLAH KHUSUS AUTIS AL-IKHLAS BUKITTINGGI TAHUN 20133239BaruStatus usulan:0027037702AKADEMI KEPERAWATAN NABILA104082Penelitian Dosen PemulaKode:405

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHIDAYATUL RAHMIPENGARUH PEMBERIAN JUS BUAH BELIMBING (AVERRHOA CARAMBOLA) TERHADAP PERUBAHAN TEKANAN DARAH PADA PENDERITA HIPERTENSI DI PANTI SOSIALTRESNA WERDA “KASIH SAYANG IBU BATUSANGKAR TAHUN 2013.3240BaruStatus usulan:1007018402AKADEMI KEPERAWATAN NABILA104082Penelitian Dosen PemulaKode:DEVI MEKAR SARIFAKTOR – FAKTOR YANG BERHUBUNGAN TERJADINYA FLEBITIS PADA PASIEN DI RUANGAN EMPAT BESAR (PENYAKIT DALAM, BEDAH, IKA DAN KEBIDANAN) RSUD PARIAMAN TAHUN 20133241BaruStatus usulan:1007077801AKADEMI KEPERAWATAN NABILA104082Penelitian Dosen PemulaKode:MERRY THRESSIAPemanfaatan Limbah Kulit Kacang Tanah (Arachis hypogaea L) sebagai Penyerap Logam Berat Merkuri3242BaruStatus usulan:1025057902Akademi Teknik Gigi YLPTK Padang104124Penelitian Dosen PemulaKode:WARNIA NENGSIHAnalisa Kelayakan Pembukaan Cabang Baru Bisnis Usaha dengan Menggunakan Decision Tree Kombinasi Naive Bayes Classification3243BaruStatus usulan:1024118205POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:KARTINA DIAH KUSUMAWARDANIWeb Mining untuk ekstraksi model proses bisnis pada aplikasi web3244BaruStatus usulan:1020048301POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:ELVA SUSIANTIImpelementasi Trajectory Tiruan Pada Robot Bipedal3245BaruStatus usulan:1027087605POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:RIZKI DIAN RAHAYANIPERBANDINGAN PENERAPAN MODEL PROPAGASI FREE SPACE PATHLOSS DAN LOG DISTANCE PATHLOSS PADA INDOOR WIFI POSITIONING SYSTEM UNTUK SMARTPHONE ANDROID3246BaruStatus usulan:1021108001POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:LUQMAN HAKIMANALISA SUARA PASIEN GANGGUAN / PENYAKIT PADA DAERAH TENGGOROKAN DALAM DOMAIN WAKTU-FREKUENSI MENGGUNAKAN TRANSFORMASI WAVELET3247BaruStatus usulan:1020128301POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:406

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHENI RACHMAWATIImplementasi Pemrosesan Paralel untuk Pewarnaan Graph dalam Membangun Perangkat Lunak Penjadwalan Kuliah Politeknik Caltex Riau3248BaruStatus usulan:1023098202POLITEKNIK CALTEX105002Penelitian Dosen PemulaKode:FENTY KURNIA OKTORINA ST., M.ScRancang Bangun Aplikasi Web Tugas Akhir Mahasiswa Politeknik Kampar 3249BaruStatus usulan:1031107801Politeknik Kampar105009Penelitian Dosen PemulaKode:ROMI YADIPengaruh Kemiringan Benda Kerja dan Parameter Proses Pemesinan Terhadap Getaran Mesin Frais Universal Knuth UFM 23250BaruStatus usulan:1004057901Politeknik Kampar105009Penelitian Dosen PemulaKode:FATMAYATIPemurnian Gliserol Hasil Samping Produksi Biodiesel Berbahan Baku Stearin Sawit3251BaruStatus usulan:1001088001Politeknik Kampar105009Penelitian Dosen PemulaKode:NINA VERONIKAPengaruh Campuran Pelarut Heksana-Aseton pada Proses Ekstraksi Karoten dari Spent Bleaching Earth Miniplant Minyak Goreng Politeknik Kampar3252BaruStatus usulan:1024057902Politeknik Kampar105009Penelitian Dosen PemulaKode:MOHAMMAD WAHYU AGANG S.Hut., M.Optimalisasi Pendapatan Hutan Tanaman Dalam Permodelan Kombinasi Pengelolaan Di Provinsi Kalimantan Timur3253BaruStatus usulan:1108048901UNIVERSITAS 17 AGUSTUS 1945 SAMARINDA111001Penelitian Dosen PemulaKode:SRI ENDAYANI S.Hut., M.P.Pemanfaatan Citra Quickbird Untuk Pemetaan Ruang Terbuka Hijau Wilayah Kecamatan Samarinda Kota Provinsi Kalimantan Timur3254BaruStatus usulan:1130127001UNIVERSITAS 17 AGUSTUS 1945 SAMARINDA111001Penelitian Dosen PemulaKode:SURATMI S.T., M.T.Penanggulangan Longsoran Ruas Jalan Kelurahan Bukit Pinang Samarinda Ulu Provinsi Kalimantan Timur3255BaruStatus usulan:1117037002UNIVERSITAS 17 AGUSTUS 1945 SAMARINDA111001Penelitian Dosen PemulaKode:407


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAISTIANA HERIANIPERLINDUNGAN KONSUMEN TERHADAP MARAKNYA PEMADAMAN LISTRIK DI BANJARMASIN DIKAITKAN DENGAN HAK-HAK KONSUMEN3264BaruStatus usulan:1125017902UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:ABDUL HALIQ S.Sos., M.Si.Analisis Indeks Kepuasan Masyarakat (IKM) Terhadap Pelayanan Publik Yang Diberikan Oleh Kecamatan Kota Banjarmasin3265BaruStatus usulan:1125057701UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:GUSTI RUSYDI FURQON SYAHRILLAH ST, MT.PEMBUATAN BAHAN BAKAR CAIR DARI SAMPAH BATU BARA (LOW RANK COAL)3266BaruStatus usulan:1128106902UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:MEILYA FARIKA INDAH S.KM. M.Sc.FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KELELAHAN KERJA PADA PENGEMUDI MOBIL TANGKI DI PT. ELNUSA Tbk BANJARMASIN3267BaruStatus usulan:1124057901UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:NOVRIAN DONY M.SiPemanfaatan Limbah Baterai Bekas Dalam Pembuatan Nano Partikel ZnO Untuk Penjernihan Air Rawa Gambut dengan Menggunakan Sinar Matahari3268BaruStatus usulan:1112118301UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:DEWI MERDAYANTYPersepsi Mahasiswa terhadap Kualitas Pelayanan Perpustakaan Universitas Swasta di Kota Banjarmasin 3269BaruStatus usulan:1104017302UNIVERSITAS ISLAM KALIMANTAN M A B BANJARMASIN111003Penelitian Dosen PemulaKode:DONNA YOULLA S.P., M.E.M.Analisis Korelational Rehabilitasi Lahan dan Hutan Terhadap Tingkat Produktivitas Masyarakat Hutan Lindung Tiung Kandang Di Kabupaten Sanggau3270BaruStatus usulan:1112027601UNIVERSITAS PANCA BHAKTI111004Penelitian Dosen PemulaKode:SETIAWAN S.P.Pengelolaan Biomasa Gulma Cromolaena odorata dan Limbah Tanaman Jagung Untuk meningkatkan Produktifitas Beberapa Kultivar Brassica oleracea Var. Botrytis. L Di tanah Ultisol3271BaruStatus usulan:1115117601UNIVERSITAS PANCA BHAKTI111004Penelitian Dosen PemulaKode:409

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMASRI WIDARTI S.P., M.P.Pemodelan Pengembangan Sumber Daya Manusia Penyuluh Pertanian Dalam Rangka Peningkatan Produktivitas Tenaga Penyuluh Di Kabupaten Kubu Raya3272BaruStatus usulan:1101037301UNIVERSITAS PANCA BHAKTI111004Penelitian Dosen PemulaKode:Ir. AGUS SUYANTO MMAEfektivitas Trichoderma Sp Dan Mikro Organisme Lokal (MOL) Sebagai Dekomposer Dalam Meningkatkan Kualitas Pupuk Organik Alami Dari Beberapa Limbah Tanaman Pertanian 3273BaruStatus usulan:0003086701UNIVERSITAS PANCA BHAKTI111004Penelitian Dosen PemulaKode:HAMIDAH SP.,MPEFEK PEMBERIAN AIR CUCIAN BERAS DAN AMPAS TEH TERHADAP PERTUMBUHAN DAUN BAWANG3274BaruStatus usulan:1117017401UNIVERSITAS WIDYA GAMA MAHAKAM SAMARINDA111007Penelitian Dosen PemulaKode:ABDUL ROFIK S.P, M.PPertumbuhan Tanaman Pisang Rutai (Musa borneensis) Pada Pemberian Pupuk Kompos Limbah Batang Pisang dan Pupuk NPK Phonska3275BaruStatus usulan:1116117001UNIVERSITAS WIDYA GAMA MAHAKAM SAMARINDA111007Penelitian Dosen PemulaKode:SUYANTO SE.,M.Si.PEMBINAAN KEWIRAUSAHAAN3276BaruStatus usulan:0009087701UNIVERSITAS WIDYA GAMA MAHAKAM SAMARINDA111007Penelitian Dosen PemulaKode:ARISTA DAMAYANTI S.P.Analisis Usaha Pengolahan Lateks Karet Pada PT. Budiduta Agromakmur Kecamatan Loa Kulu Kabupaten Kutai Kartanegara3277BaruStatus usulan:1112058201UNIVERSITAS KUTAI KARTANEGARA TENGGARONG111008Penelitian Dosen PemulaKode:ASTIK DRIANTI SP., MP.DAMPAK PASAR MALAM TERHADAP TATANIAGA HASIL PERTANIAN DI KECAMATAN TENGGARONG KABUPATEN KUTAI KARTANEGARA3278BaruStatus usulan:0008117901UNIVERSITAS KUTAI KARTANEGARA TENGGARONG111008Penelitian Dosen PemulaKode:SUAIBATUL ASLAMIAH S.Hut.,M.PIDENTIFIKASIKANDUNGAN GOLONGAN SENYAWA YANG TERDAPAT PADA DAUK POHON KAPUK (CEIBA PENTANDRA L.) SEBAGAI OBAT TRADISIONAL3279BaruStatus usulan:1127117803UNIVERSITAS MUHAMMADIYAH PALANGKA RAYA111009Penelitian Dosen PemulaKode:410

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAADY FERDIAN NOOR SE, M.Pd.kompetensi Mengajar Calon Guru SD (Studi Kasus Mahasiswa Program Studi PGSD FKIP UM Palangkaraya)3280BaruStatus usulan:1102037501UNIVERSITAS MUHAMMADIYAH PALANGKA RAYA111009Penelitian Dosen PemulaKode:SITI MAIMUNAH S.HUT.,M.P.Studi Morfologi Perbungaan Dan Uji Viabilitas Benih Pada Berbagai Tingkat Kemasakan Buah Kahoi (Shorea Balangeran)3281BaruStatus usulan:1131017603UNIVERSITAS MUHAMMADIYAH PALANGKA RAYA111009Penelitian Dosen PemulaKode:NIRWANA PUSPASARIKORELASI HARGA CALIFORNIA BEARING RATIO (CBR) DAN TAHANAN UJUNG KONUS UNTUK TANAH DI PALANGKA RAYA3282BaruStatus usulan:1102057301UNIVERSITAS MUHAMMADIYAH PALANGKA RAYA111009Penelitian Dosen PemulaKode:RITA RAHMANIATIPENGEMBANGAN LKM "BETANG" UNTUK MENINGKATKAN KEMANDIRIAN DAN KETERAMPILAN BERFIKIR KRITIS MAHASISWA3283BaruStatus usulan:1007058301UNIVERSITAS MUHAMMADIYAH PALANGKA RAYA111009Penelitian Dosen PemulaKode:TANIA SEREZOVA AUGUSTAStudi Komunitas Zooplankton Di Danau Hanjalutung Berdasarkan Jenis Tutupan Vegetasi3284BaruStatus usulan:1111087401UNIVERSITAS KRISTEN PALANGKA RAYA111010Penelitian Dosen PemulaKode:LUKAS S.PI M.SI S.Pi., M.SiStudi Komposisi Isi Lambung dan Kondisi Morfologi Ikan Lais (Ompok hypopthalmus) Yang Tertangkap Di Rawa Banjiran Sungai Rungan Kota Palangka Raya3285BaruStatus usulan:1114107302UNIVERSITAS KRISTEN PALANGKA RAYA111010Penelitian Dosen PemulaKode:Ir ZAM ZAMI MTPEMBUATAN INSTALASI POMPA SENTRIFUGAL SECARA TUNGGAL SERIDAN PARALEL UNTUK PENGUJIAN PRATIKUM DI LABORATORIUM FAKULTAS TEKNIK, UNIVERSITAS MUHAMMADIYAH PONTIANAK3286BaruStatus usulan:1110105201UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:SELVIANAFaktor-Faktor Yang Berhubungan Dengan Infeksi Soil Transmitted Helminths (STH) Pada Murid SD Di Wilayah Terisolir Di Kabupaten Kubu Raya3287BaruStatus usulan:1122028801UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:411

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAABDUH RIDHA M.P.HPerilaku Merokok Sebagai Faktor Risiko Penyakit Jantung Koroner: Studi Epidemiologi di Rumah Sakit Umum Dr. Sudarso Pontianak3288BaruStatus usulan:1115088402UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:RIZMAHARDIAN ASHARI KURNIAWANKARAKTERISASI ENZIM SELULASE ISOLAT BAKTERI TANAH GAMBUT KOTA PONTIANAK Pseudomonas sp. RGC113289BaruStatus usulan:1115018701UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:EDY SURYADI SE, MMAnalisis Kepuasan Masyarakat Terhadap Pelayanan Sektor Pendidikan di Kabupaten Kayong Utara Provinsi Kalimantan Barat3290BaruStatus usulan:1110026301UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:SRI NUGROHOJATIStudi Komparasi Hasil Assertiveness Rating Scale dan The Rathus Assertiveness Schedule Pada Mahasiswa PG-PAUD Angkatan Tahun 2011 dan 2012 Di Universitas Muhammadiyah Pontianak3291BaruStatus usulan:1126047601UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:TUTI KURNIATIPEMBELAJARAN SAINS BERBASIS EDUTAINMENT DENGAN PENDEKATAN GUIDE DISCOVERY-INQUIRY UNTUK MENINGKATKAN KETERAMPILAN BERPIKIR KRITIS PADA SISWA MTsN 1 PONTIANAK3292BaruStatus usulan:1109108501UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:ELLY TRISNAWATI M.ScRISIKO ANEMIA DAN KELELAHAN KERJA PADA PEKERJA WANITA DENGAN PERAN GANDA DI PERUSAHAAN PLYWOOD KABUPATEN KUBU RAYA KALIMANTAN BARAT3293BaruStatus usulan:1108117901UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:DEDEH KURNIASIH M.SiPembuatan Media Pembelajaran Berbasis Flash pada Praktikum Kimia Analitik I Sebagai Upaya Meningkatkan Prestasi Belajar Mahasiswa Pendidikan Kimia Universitas Muhammadiyah Pontianak3294BaruStatus usulan:1109128501UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:M.TAUFIK SKM.,M.K.MFAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN PENINGKATAN FERTILITAS PADA WANITA PASANGAN USIA SUBUR DI PROPINSIKALIMANTAN BARAT3295BaruStatus usulan:1109048501UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:412

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAMARLENYWATI S.Si.,M.KMHUBUNGAN ANTARA USIA, TINGKAT PENDIDIKAN DAN DUKUNGAN SUAMI DENGAN KECEMASAN PADA IBU HAMIL TRIMESTER AKHIR MENJELANG PERSALINAN DI KOTA PONTIANAK 3296BaruStatus usulan:1129098301UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:ISKANDAR ARFANSexual Lifestyles Dan Hubungan Interpersonal Pada Remaja Di Kota Pontianak Dan Implikasinya Pada Kesehatan Seksual Dan Reproduksi3297BaruStatus usulan:1129108601UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:ANDRI DWI HERNAWAN SKM, M.Kes (Epid)Faktor budaya dan gaya hidup yang berisiko terhadap kejadian hipertensi pada lansia(studi di posyandu lansia wilayah kerja puskesmas sambas kabupaten sambas)3298BaruStatus usulan:1104018201UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:ISMAEL SALEHStudi komparasi kepadatan jentik, spesies, dan breeding place nyamuk Anopheles sp pada tiap tingkatan daerah endemis malaria (Studi di wilayah kerja Puskesmas Subah Kabupaten Sambas)3299BaruStatus usulan:1204097901UNIVERSITAS MUHAMMADIYAH PONTIANAK111013Penelitian Dosen PemulaKode:ROSMAWIAH SH., MH.STUDI TENTANG PENYALAHGUNAAN WEWENANG TERHADAP TINDAK PIDANA KORUPSI3300BaruStatus usulan:1117046901UNIVERSITAS PGRI PALANGKA RAYA111015Penelitian Dosen PemulaKode:ANA SUHERI SH., MHILLEGAL LOGGING DALAM PERSPEKTIF PENEGAKAN HUKUM LINGKUNGAN3301BaruStatus usulan:1115117001UNIVERSITAS PGRI PALANGKA RAYA111015Penelitian Dosen PemulaKode:SRIYANA S.Sos,M.SiPENYELENGGARAAN ADMINISTRASI PEMERINTAHAN KELURAHAN DENGAN TEKNOLOGI INFORMASI BERBASIS NOMOR INDUK KEPENDUDUKAN DI KELURAHAN KERENG BANGKIRAI KECAMATAN SABANGAU KOTA PALANGKA RAYA3302BaruStatus usulan:0027087201UNIVERSITAS PGRI PALANGKA RAYA111015Penelitian Dosen PemulaKode:TEGUH PRIBADI S. Hut., M. Si.Keanekaragaman Rayap: Peranan Kawasan Semi Alami sebagai Cagar Keanekaragaman Rayap di Perkebunan Kelapa Sawit3303BaruStatus usulan:0027128001UNIVERSITAS PGRI PALANGKA RAYA111015Penelitian Dosen PemulaKode:413

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANURUL HIDAYATI S.P., M.P.Kajian Pemanfaatan Abu Boiler Terhadap Pertumbuhan dan Hasil Tomat3304BaruStatus usulan:0025077301UNIVERSITAS PGRI PALANGKA RAYA111015Penelitian Dosen PemulaKode:SOEDJATMIKO SE, MA, Ak.Determinan Umur Perusahaan, Risiko Lingkungan, Siklus Operasi, Dan Likuiditas Terhadap Kualitas Pelaporan Keuangan 3305BaruStatus usulan:1116077501SEKOLAH TINGGI ILMU EKONOMI NASIONAL BANJARMASIN113005Penelitian Dosen PemulaKode:RIA MAYASARI S.Pd.,M.Pd.IMPLEMENTASI MODEL PEMBELAJARAN BERDASARKAN MASALAH PADA PEMBELAJARAN BIOLOGI TERHADAP HASIL BELAJAR DAN KETERAMPILAN BERPIKIR TINGKAT TINGGI DI SMA3306BaruStatus usulan:1121068301STKIP PGRI BANJARMASIN113006Penelitian Dosen PemulaKode:ABDUL JABAR M.PdPenerapan pendekatan problem posing untuk meningkatkan kemampuan pemecahan masalah pada materi sistem persamaan linear kelas XA Multimedia SMK Negeri 3 Banjarmasin tahun pelajaran 2013/20143307BaruStatus usulan:0014067901STKIP PGRI BANJARMASIN113006Penelitian Dosen PemulaKode:ELI TRISNOWATIPENGEMBANGAN PROGRAM PELATIHAN KETERAMPILAN KONSLEING BAGI KONSELOR DI SMP/Mts NEGERI SE-KOTA PONTIANAK KALIMANTAN BARAT3308BaruStatus usulan:1130127901STKIP PGRI PONTIANAK113008Penelitian Dosen PemulaKode:ARDIAN ARIFINPenerapan Model Pembelajaran Koorperatif Berbantu Media Komputer Terhadap Prestasi Belajar Dan Motivasi Belajar Pada Materi Strategi Belajar Mengajar Pada Mahasiswa Calon Guru Tik3309BaruStatus usulan:1106067605STKIP PGRI PONTIANAK113008Penelitian Dosen PemulaKode:YUDI DARMAMengembangkan Kemampuan Pemecahan Masalah Melalui Pembelajaran Strategi Heuristik dengan Pendekatan Metakognitif Ditinjau dari Kemandirian Belajar Mahasiswa Calon Guru Matematika pada Konsep Analisis Data Statistik3310BaruStatus usulan:1119068701STKIP PGRI PONTIANAK113008Penelitian Dosen PemulaKode:HANDI DARMAWANRELEVANSI KEMAMPUAN BERBICARA DAN PENGUASAAN KONSEP MATERI DENGAN KETERAMPILAN MENJELASKAN PADA PRAKTEK PENGAJARAN MIKRO BAGI CALON GURU BIOLOGI STKIP PERSADA SINTANG3311BaruStatus usulan:1105077903STKIP PGRI PONTIANAK113008Penelitian Dosen PemulaKode:414

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMANIDIA ROSMAWANTI SKOM, MKOMModel Penunjang Keputusan Berbasis k-Nearest Neighbor Menggunakan Kombinasi Basis Aturan dan Basis Pengetahuan3312BaruStatus usulan:1128127401STMIK BANJARBARU113048Penelitian Dosen PemulaKode:TAUFIQ SKOM, MKOMSistem Pakar Untuk Menganalisa Penyebab Kerusakan Pada Printer( Studi Kasus Printer Canon IP Series Tipe Inkjet )3313BaruStatus usulan:1126127501STMIK BANJARBARU113048Penelitian Dosen PemulaKode:SUDJATMIKO SETYOBUDIHONOHUBUNGAN PENGARUH SOSIAL TERHADAP NIAT BEROBAT SUPLEMENTASI BESI PADA IBU HAMIL DENGAN ANEMIA DI BANJARMASIN3314BaruStatus usulan:1116116801Sekolah Tinggi Ilmu Kesehatan Cahaya Bangsa113051Penelitian Dosen PemulaKode:MAHDIANNOOR M.P.Pertumbuhan dan Hasil Dua Varietas Jagung Hibrida Sebagai Tanaman Sela Dibawah Tegakan Karet3315BaruStatus usulan:0006067901SEKOLAH TINGGI ILMU PERTANIAN AMUNTAI113054Penelitian Dosen PemulaKode:HADIYANTO S.T.,M.Eng.MODEL SISTEM INFORMASI KESEHATAN UNTUK IBU HAMIL DAN BALITA DENGAN TEKNOLOGI SMS GATEWAY PADA WILAYAH BONTANG KEPULAUAN3316BaruStatus usulan:1108078001SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:NILAM SARI S.Si.,M.SiAnalisis Tutupan Terumbu Karang di Perairan Laut Kota Bontang3317BaruStatus usulan:1101017201SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:ABDUL ZAINStudi Penurunan Kadar Logam Besi (Fe) dan Logam Mangan (Mn) Pada Lempung Daerah Bontang Dengan Penyaring Elektromagnetik3318BaruStatus usulan:1111037801SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:LAPU TOMBI LAYUKperancangan prototype aplikasi optimalisasi distribusi pengangkutan sampah di bontang3319BaruStatus usulan:1120107301SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:415

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMABENI UTOMO S.Si., M.Sc.MODEL PEMBELAJARAN ANAK BERKEBUTUHAN KHUSUS DALAMBERMAIN DAN BELAJAR MENGGUNAKAN VISUAL BASIC DAN MIKROKONTROLLER ATMEGA163320BaruStatus usulan:1109077801SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:ARIEF MULIAWAN S.Si.,M.ScAnalisis Sifat Fisik Dan Mineral Pada Proses Sintering Kulit Kerang Berbasis Lempung Sebagai Bahan Baku Pembuatan Keramik Isolator3321BaruStatus usulan:1118038601SEKOLAH TINGGI TEKNOLOGI BONTANG113056Penelitian Dosen PemulaKode:ASON S.Pd,M.PdPENGEMBANGAN MODEL PEMBELAJARAN TEMATIK UNTUK MENINGKATKAN KOMPETENSI MEMBACA MENULIS DAN BERHITUNG PADA SISWA SEKOLAH DASAR DI DAERAH PEDALAMAN KABUPATEN MELAWI 3322BaruStatus usulan:1101016506STKIP MELAW I113067Penelitian Dosen PemulaKode:RINA GUNARTIMENINGKATKAN HASIL BELAJAR MAHASISWA PADA MATA KULIAH MIK I DENGAN MENGGUNAKAN MODEL PEMBELAJARAN KOOPERATIF TIPE JIGSAW PADA MAHASISWA DIII PEREKAM DAN INFORMASI KESEHATAN STIKES HUSADA BORNEO BANJARBARU TAHUN 20143323BaruStatus usulan:1122058601STIKES Husada Borneo113071Penelitian Dosen PemulaKode:NINA RAHMADILIYANI S.Kep, M.PHModel Pembelajaran Asuhan Kebidanan Patologi Berbasis Pendidikan Karakter pada Mahasiswa DIV Bidan Pendidik Stikes Husada Borneo tahun 20143324BaruStatus usulan:1112118202STIKES Husada Borneo113071Penelitian Dosen PemulaKode:MARJAN WAHYUNI S.KM., M.Si.efektifitas pencampuran ekstrak daun bengkuang (Pachyrrhyzus erosus) dan daun sirih (Piper betle) sebagai larvasida alami untuk mematikan larva nyamuk Aedes aegypti 3325BaruStatus usulan:1109017501STIKES Muhammadiyah Samarinda113082Penelitian Dosen PemulaKode:EKA SISWANTO SYAMSULUJI DAYA ANALGETIK EKSTRAK ETANOLIKDAUN BINAHONG [Anredera cordifolia (Ten.) Steenis]PADA MENCIT PUTIH (Mus musculus L.) JANTAN3326BaruStatus usulan:1108038201AKADEMI FARMASI SAMARINDA114054Penelitian Dosen PemulaKode:SITI JUBAIDAHUJI BIOAKTIVITAS EKSTRAK AKAR TABAR KEDAYAN (Aristolochia foveolata Merr)3327BaruStatus usulan:1109098302AKADEMI FARMASI SAMARINDA114054Penelitian Dosen PemulaKode:416

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMARISA SUPRININGRUMUJI TOKSISITAS AKUT EKSTRAK AKAR TABAR KEDAYAN (Aristolochia papillifolia. Ding Hou)3328BaruStatus usulan:1110016801AKADEMI FARMASI SAMARINDA114054Penelitian Dosen PemulaKode:HAYATUS SA ADAHOPTIMASI FORMULA GRANUL EKSTRAK UMBIBAWANG DAYAK (Eleutherine americana Merr.) MENGGUNAKAN AEROSIL DAN AVICEL PH 1013329BaruStatus usulan:0027127701AKADEMI FARMASI SAMARINDA114054Penelitian Dosen PemulaKode:HUSNUL WARNIDAFORMULASI MIKROEMULSI MINYAK IKAN PATIN (Pangasius djambal oil ) DENGAN VARIASI TWEEN 80 SEBAGAI SURFAKTAN3330BaruStatus usulan:0007067701AKADEMI FARMASI SAMARINDA114054Penelitian Dosen PemulaKode:LISA ANDINAANALISIS KUALITAS DAN TINGKAT OKSIDASI MINYAK GORENG CURAH YANG DIGUNAKAN PADA WARUNG MAKAN SEAFOOD KAKI LIMA MENGGUNAKAN SPEKTROFOTOMETER FTIR dan KEMOMETRIKA3331BaruStatus usulan:1123038303Akademi Analis Kesehatan Borneo Lestari Banjarbaru114094Penelitian Dosen PemulaKode:SUGIANTO S.E., M.M.Analisis Pengaruh Technology Acceptance Model (TAM) dan Perceived Enjoyment terhadap Kepuasan Konsumen Pengguna M-Business 3332BaruStatus usulan:1114058401POLITEKNIK TONGGAK EQUATOR115001Penelitian Dosen PemulaKode:EMILIA FARIDA BUDI HANDAYANI S.P.Pengaruh Sludge Palm Oil dan Jarak Tanam Jajar Legowo terhadap Pertumbuhan dan Produksi Jagung Hibrida Varietas Bisi 23333BaruStatus usulan:1130066901POLITEKNIK TONGGAK EQUATOR115001Penelitian Dosen PemulaKode:Ir. ANASTASIA ARI MARTIYANTIOptimasi Penambahan Kedelai dan CMC Untuk Meningkatkan Kandungan Gizi dan Stabilitas Minuman Sari Jagung Manis3334BaruStatus usulan:1115036201POLITEKNIK TONGGAK EQUATOR115001Penelitian Dosen PemulaKode:MUHDARPENGARUH MOTIVASI INTRINSIK DAN EKSTRINSIKTERHADAP KINERJA DOSEN POLITEKNIK KOTABARUKALIMANTAN SELATAN3335BaruStatus usulan:1103037301POLITEKNIK KOTABARU115004Penelitian Dosen PemulaKode:417

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAIRFAN S.TDesain Pembangkit Listrik Hybrid (Tenaga Matahari dan Tenaga Angin Memnggunakan Kincir Angin Sumbu Vertikal) berbasis mikrokontroler3336BaruStatus usulan:1117127301POLITEKNIK KOTABARU115004Penelitian Dosen PemulaKode:AHMADIL AMIN ST., MTAnalisis Struktur Mikro dan Fraktografi Hasil Pengelasan GMAW Metode Temper Bead Welding dengan Variasi Temperatur Interpass pada Baja Karbon Sedang3337BaruStatus usulan:0007077601POLITEKNIK KOTABARU115004Penelitian Dosen PemulaKode:RIKA SYLVIA S.E., M.MAnalisis strategi pengembangan obyek wisata Air Terjun Tumpang Dua di Kabupaten Kotabaru Kalimantan Selatan3338BaruStatus usulan:0024097502POLITEKNIK KOTABARU115004Penelitian Dosen PemulaKode:MARTANTOFOOD GRADE GREASE BERBAHAN BAKU MINYAK SAWIT CRUDE PALM OIL (CPO) OFF GRADE DENGAN VARIASI KONSENTRASI THICKENING AGENT DAN BERUBAHAN SIFAT FISIKOKIMIA SELAMA PENYIMPANAN 3339BaruStatus usulan:1126097802Politeknik Ketapang115007Penelitian Dosen PemulaKode:EPRIYANDIPerancangan Sistem Informasi Manajemen Laboratorium Teknik Mesin Politeknik Ketapang Berbasis Human Computer Interaction(HIC)3340BaruStatus usulan:1105018402Politeknik Ketapang115007Penelitian Dosen PemulaKode:ENCIK EKO RIFKOWATYMINUMAN FUNGSIONAL SERBUK JAHE ( Zingiber officinale rosc ) DENGAN PENAMBAHAN EKSTRAK BAWANG MEKAH SEBAGAI BAHAN PEWARNA ALAMI3341BaruStatus usulan:1117028502Politeknik Ketapang115007Penelitian Dosen PemulaKode:ADHA PANCA WARDANUANALISA NILAI TAMBAH DAN KELAYAKAN AGROINDUSTRI NATA DE COCO DI KABUPATEN KETAPANG3342BaruStatus usulan:1117098305Politeknik Ketapang115007Penelitian Dosen PemulaKode:IRIANTO SASTRO PRAWIROREKAYASA PEMBUATAN BIOETANOL BERBAHAN BAKU LIMBAH TANDAN KOSONG KELAPA SAWIT PADA PERLAKUAN LAMA FERMENTASI DAN DOSIS RAGI DENGAN METODE HOT COMPRESSED-WATER TEMPERATUR 220ºC3343BaruStatus usulan:1126098401Politeknik Ketapang115007Penelitian Dosen PemulaKode:418

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANTO SUSANTOREKAYASA PEMBUATAN NANOENKAPSULAN EKSTRAK BUAH PEDADA (Sonneratia caseolaris) SEBAGAI ANTIOKSIDAN ALAMI DAN SIFAT FISIKOKIMIA YANG DIHASILKAN3344BaruStatus usulan:1126058301Politeknik Ketapang115007Penelitian Dosen PemulaKode:NENENGSIH VERAWATIAnalisis bakteri coliform pada air sumur dan air PDAM Dikecamatan Benua Kayong Kabupaten Ketapang Kalimantan Barat3345BaruStatus usulan:1110038201Politeknik Ketapang115007Penelitian Dosen PemulaKode:HAIRIAN RAHMADIPENGARUH PENCAMPURAN LIMBAH SAWIT DAN KOTORAN SAPITERHADAP LAMANYA WAKTU TERJADINYA PROSES BIOGAS DANWARNA NYALA API3346BaruStatus usulan:1110097901Politeknik Ketapang115007Penelitian Dosen PemulaKode:MUH ANHARANALISA PREFERENSI KONSUMEN TERHADAP ATRIBUT RASA TIGA JENIS KERUPUK AMPLANG PRODUKSI TOKO OBIC DI KABUPATEN KETAPANG 3347BaruStatus usulan:1122077403Politeknik Ketapang115007Penelitian Dosen PemulaKode:HELANIANTO“PENGARUH REGANGAN PADA MATERIAL LOGAM BAJA TERHADAP KEKERASAN DAN SIFAT GETARAN”3348BaruStatus usulan:1111057801Politeknik Ketapang115007Penelitian Dosen PemulaKode:DHAMAS MEGA AMARLITAANALISIS KEMAMPUAN MAKROSKOPIS, MIKROSKOPIS DAN SIMBOLIK DALAM PEMBELAJARAN LEARNING CYCLE 5 FASE PADA MATERI KESETIMBANGAN KIMIA3349BaruStatus usulan:1227058101UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:ATY UARIMPLEMENTASI PRINSIP-PRINSIP GOOD GOVERNANCE PADA BPN KOTA AMBON (Studi Tentang Penyelesaian Sertifikat Hak Milik Atas Tanah Di Desa Batu Merah Kecamatan Sirimau).”3350BaruStatus usulan:1208057402UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:SYARIF OHORELLA S.Hut, M.SiINVENTARISASI BIOMASSA KOMPONEN VEGETASI PADA TIPE LAHAN AGROFORESTRI DUSUN (Suatu Kajian untuk membangun persamaan Alometrik Biomassa Tanaman pada Tipe Lahan Agroforestri Dusun)3351BaruStatus usulan:1216117801UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:419

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAASMA KARIMPeran Pemerintah Daerah Maluku Tengah Dalam Perlindungan Hukum Indikasi Geografis Pala Banda Sebagai Upaya Pemberdayaan Ekonomi Rakyat3352BaruStatus usulan:1210058101UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:ABDULLATIF TUASAMUAnalisis Karakteristik Tujuan Anggaran, Perilaku, Sikap, dan Pengaruhnya terhadap Kinerja Aparat Kabupaten Maluku Tengah di Masohi3353BaruStatus usulan:1210046101UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:SITNAH AISYAH MARASABESSY S.T., M.T.IDENTIFIKASI SISTEM PRODUKSI DAN FORMULASI STRATEGI KORPORASI UNTUK IKM ABON IKAN3354BaruStatus usulan:1226017701UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:HUSAIN LATUCONSINA S.Pi., M.SiDISTIRBUSI HARIAN IKAN PADANG LAMUN TERKAIT KEBERADAAN MANGROVE DAN TERUMBU KARANG DI PERAIRAN PULAU BUNTAL TELUK KOTANIA – KABUPATEN SERAM BAGIAN BARAT3355BaruStatus usulan:1214057901UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:DAYANTOPelaksanaan Hak Partisipasi Masyarakat Dalam Pembentukan Peraturan Daerah Di Kabupaten Maluku Tengah3356BaruStatus usulan:1206048302UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:ABDULLAH DERLEANIMPLEMENTASI MODEL PEMBELAJARAN LEARNING CYCLE TIGA FASE UNTUK MENINGKATKAN KEMAMPUAN BERPIKIR KRITIS SISWA PADA PEMBELAJARAN SAINS SMP3357BaruStatus usulan:1204107201UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:ALI ROHO TALAOHUPERAN PEMERINTAH NEGERI DALAM PROSES PEMBERDAYAAN MASYARAKAT PESISIR DI BIDANG SDM, POLITIK, DAN EKONOMI(STUDI KASUS DI KECAMATAN SALAHUTU, KABUPATEN MALUKU TENGAH)3358BaruStatus usulan:1227128501UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:INEM ODE S.Pi., MPKadar Alginat Alga Coklat yang Tumbuh di Perairan Pantai Desa Hutumuri Pulau Ambon3359BaruStatus usulan:0012087701UNIVERSITAS DARUSSALAM AMBON121002Penelitian Dosen PemulaKode:420


NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAANDI THAMRIN SPPrioritas Pengembangan Sub Sektor Agroindustri di Provinsi Maluku Utara3368BaruStatus usulan:0016067201UNIVERSITAS MUHAMMADIYAH MALUKU UTARA121005Penelitian Dosen PemulaKode:TRI WAHYUNINGSIHRANCANGAN MODEL PERENCANAAN PEMBANGUNAN SEKTOR PERTANIAN POTENSIAL UNTUK PERCEPATAN PERTUMBUHAN EKONOMI DAN DAYA SAING WILAYAH DI KABUPATEN BURU3369BaruStatus usulan:1204057801UNIVERSITAS IQRA BURU121007MP3EIKode:MUHAMMAD BULAANALISIS PENGARUH DEBIT DAN TINGGIH JATUH AIR WADUK WAIDINI TERHADAP POTENSI PEMBANGKIT LISTRIKTENAGA MIKRO HIDRO DI DESA SAVANA JAYAKABUPATEN BURU MALUKU3370BaruStatus usulan:0020017902UNIVERSITAS IQRA BURU121007Penelitian Dosen PemulaKode:NORMALIA ODE YANTHY M.TStrategi Pengembangan Potensi Wilayah Sebagai Upaya Pemerataan Pembangunan Di Kabupaten Jayawijaya3371BaruStatus usulan:1228058201UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:Ir. A MUID FABANYO M.MTStudi Jatuh Tegangan Pada Feeder 20KV Terhadap Jarak Penempatan Transformator Distribusi Di Kabupaten Jayapura3372BaruStatus usulan:1224106301UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:MURATNO S.T.M.MTPenentuan kelayakan instalasi listrik 450 VA setelah Pemakaian 10 Tahun ( studi kasus) pada Distrik Koya Timur Kabupaten Keerom)3373BaruStatus usulan:1211056702UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:INAYATUL ILAH NASHRUDDIN S.T, MScKARAKTERISTIK AKTIVITAS PEDAGANG KAKI LIMA DI SEKITAR JALAN POROS KOTAStudi Kasus: Jalan Raya Abepura, Jalan Raya Sentani – Padang Bulan, dan Jalan Raya Sentani – Waena3374BaruStatus usulan:1231088501UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:ARIA ADITYA SETIAWAN S.IP., M.Si.PERAN PEMERINTAH KABUPATEN JAYAPURA DALAM PENCAPAIAN MILLENIUM DEVELOPMENT GOALS (MDGs) DI BIDANG PENDIDIKAN TAHUN 20133375BaruStatus usulan:1216098103UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:422

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHERMAN HI TJOLLENG TABA ST.MTSTUDI AIR PENDINGIN TERHADAP KINERJA REFRIGERANT 134A PADA UNIT PENGKONDISIAN UDARA DAN POMPA PEMANAS (AIR CONDITIONER AND HEAT PUMP STUDY UNIT) TIPE 108/3D3376BaruStatus usulan:0019027601UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:THELLY SULA HENDERENA SEMBOR M.MSTUDI KESEDIAAN DAN KEMAMPUAN MEMBAYAR ANGKUTAN UMUM KOTA KE KABUPATEN PEMEKARAN DI PROPINSI PAPUA-PAPUA BARAT3377BaruStatus usulan:0018067501UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:HELEN RIUPASSA ST, MTDistribusi Temperatur Kompor Serbuk Kayu Akibat Penambahan Firewall Dengan Menggunakan Infrared Thermograph 3378BaruStatus usulan:0029067903UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:AWIA CONANG ST, MTPENGEMBANGAN TEKNOLOGI TEPAT GUNA MESIN PENGAYAK PASIR BERTINGKAT 3379BaruStatus usulan:0012018004UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:BONEFASIUS BAO S.IP., MAPotret Masyarakat Miskin di Daerah Kaya Sumber Daya Alam (Studi Kasus Implementasi Kebijakan Program Bantuan Keuangan Kepada Kampung (BK3) di Kabupaten Keerom Provinsi Papua)3380BaruStatus usulan:0005067401UNIVERSITAS SAINS DAN TEKNOLOGI JAYAPURA121008Penelitian Dosen PemulaKode:S.E MUTHMAINNAH M.Si.AkStudi Eksperimen Model Pembelajaran Melalui Media Komik Akuntansi Untuk Meningkatkan Prestasi Mahasiswa3381BaruStatus usulan:1214127701UNIVERSITAS YAPIS PAPUA121009Penelitian Dosen PemulaKode:MUKTI STOFFEL“Implementasi Hasil Penentuan Pendapat Rakyat (PEPERA) Berdasarkan New Agreement 1962 dalam kaitannya dengan Penegakan Hak Asasi Manusia di Tanah Papua”3382BaruStatus usulan:1228058301UNIVERSITAS YAPIS PAPUA121009Penelitian Dosen PemulaKode:S.H FARIDA TUHAREA M.HPerlindungan Hukum Bagi Tenaga Kerja yang bekerja pada malam hari di Kantor Televisi Mandiri Papua3383BaruStatus usulan:1211067101UNIVERSITAS YAPIS PAPUA121009Penelitian Dosen PemulaKode:423

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAHARRY A TUHUMURY S.H., M.HFungsi Dewan Perwakilan Rakyat Daerah (DPRP) Dalam Pengawasan Pelaksanaan Otonomi Daerah Di Kota Jayapura Pasca Amandemen UUD 19453384BaruStatus usulan:0006057501UNIVERSITAS YAPIS PAPUA121009Penelitian Dosen PemulaKode:ANANG MULYANTANADAMPAK PENGEMBANGAN BATARAN URBAN TERHADAP INDIKATOR BIO EKOLOGIKAL VEGETASI DI DESA WANGONGIRA KECAMATAN TOBELO TIMUR3385BaruStatus usulan:1223127701UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:JERIZAL PETRUSPROGRAM BIMBINGAN KELOMPOK BERBASIS NILAI-NILAI BUDAYA HIBUA LAMO 3386BaruStatus usulan:1222068601UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:BROERY DORO PATER TJAJALITURGI PASKAH SEBAGAI BENTUK PERDAMAIAN ANTAR UMAT YANG YANG BERKONFLIK3387BaruStatus usulan:1220108402UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:ONTJE FRANSISCA W. TUTUPARY S.Pi., M.Si.Kondisi Morfodinamika Pantai Pulau Kumo3388BaruStatus usulan:1211118201UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:ADRIAN YORO NALENGMENAKAR PEMANFAATAN MODAL SOSIAL DALAM IMPLEMENTASI KEBIJAKAN RELOKASI PASAR RAWAJAYA KE PASAR WKO.3389BaruStatus usulan:1224048601UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:LILIAN G. F. APITULEY M.Hum.Analisis Yuridis-Sosiologis terhadap UU No. 23 Tahun 2004 tentang PKDRT dalam Pemberian Perlindungan Hukum Bagi Perempuan di Tobelo-Kab. Halmahera Utara3390BaruStatus usulan:1210018101UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:Drs. JOHASAP WATSON BATAWI M.M.Pd.Masyarakat Suku Tugutil Sulit Bersekolah (Studi Kasus di Desa Lili Kecamatan Maba Utara Kabupaten Halmahera Timur.3391BaruStatus usulan:1203075001UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:424

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAELSTONSIUS BANJOParameter Unsur Melawan Hukum dan Unsur Penyalagunaan Wewenang menurut Pasal 2 dan Pasal 3 Undang-Undang Nomor 31 Tahun 1999 jo Undang-Undang Nomor 20 Tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi (Studi Kasus di Pengadilan TIPIKOR Ternate)3392BaruStatus usulan:1209126801UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:IRENA SEPTIANITA KAOMANENG SE., M.Si.Penilaian Ekonomi Kerusakan Hutan Mangrove Pulau-Pulau Kecil di Kabupaten Halmahera Utara3393BaruStatus usulan:1220098101UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:CHERLY SALAWANEMitigasi Bencana Debu Vulkanik Gunung Dukono Melalui Perangkat Pembelajaran Berpendekatan Science, Environment, Technology and Society IPA Terpadu 3394BaruStatus usulan:1210048301UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:CHENLY LOINGAnalisa Perilaku Pembelian Konsumen di Kota Tobelo Halmahera Utara3395BaruStatus usulan:1212128301UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:LOMAS BEATRIS LIMPONGPersepsi Masyarakat Terhadap Kinerja Koperasi Di Kabupaten Halmahera Utara3396BaruStatus usulan:1214126201UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:ANDRE DEMITRIUSGOOD GOVERNANCE DALAM PELAYANAN PUBLIK DI KECAMATAN TOBELO KABUPATEN HALMAHERA UTARA3397BaruStatus usulan:1215058601UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:RICARDO F NANURU S.Si., M.Phil.Analisis Pencapaian Standar Pelayanan Minimal (SPM) Pendidikan Dasar di Kecamatan Morotai Selatan, Kabupaten Pulau Morotai3398BaruStatus usulan:0007067901UNIVERSITAS HALMAHERA121015Penelitian Dosen PemulaKode:SEFNAT KRISTIANTO TOMASOAAnalisis Pergeseran Struktur Ekonomi Dan Identifikasi Sektor Basis Untuk Memaksimalkan Daya Saing Perekonomian Wilayah Kota Ambon3399BaruStatus usulan:1211067201SEKOLAH TINGGI ILMU EKONOMI MANAJEMEN RUTU NUSA123040Penelitian Dosen PemulaKode:425

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAFETY ROCHYAWATY QUDRATDAMPAK TANGIBLE DAN PENGARUHNYA PADA KEPUASAN KONSUMEN DENGAN KNOWLEDGE MANAGEMENT SEBAGAI VARIABEL MODERASI3400BaruStatus usulan:1203057102Akademi Bank Yapis124015Penelitian Dosen PemulaKode:SUNARNO SP, M.ScIdentifikasi jenis Lalat Buah ( Bactrocera,spp) Di Wilayah Galela Dan Kao Kabupaten Halmahera Utara Dengan Menggunakan Perangkap Metil Eugenol3401BaruStatus usulan:1215047501POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:MARKUS J J LATUPAPUA S.Hut, M.ScAplikasi Penggunaan Plot Ukur Permanen Dalam Memprediksi Populasi DAn Penggunaan Habitat Dari Satwa Kus - Kus (Phallanger sp) Pada Hutan Desa Meti Kecataman Tobelo Timur3402BaruStatus usulan:1209077101POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:ERNNY HUNILAPERAN DAN PROSPEK LIMBAH PERTANIAN SEBAGAI BAHAN BAKU PEMBENAH TANAH UNTUK REHABILITASI LAHAN 3403BaruStatus usulan:1207086901POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:ALFRED LODEWYK PATTY SP. M.ScKAJIAN KARAKTERISTIK CURAH HUJAN DAN NERACA AIR LAHAN UNTUK PERENCANAAN PERTANIAN DI KABUPATEN HALMAHERA UTARA3404BaruStatus usulan:1205047601POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:JOHN F SONOTO M.ScANALISIS KINERJA KEUANGAN TERHADAP KEMANDIRIAN PEMBIAYAN PENYELENGGARAAN PEMERINTAHAN DAERAH di KABUPATEN HALMAHERA UTARA3405BaruStatus usulan:1219038002POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:JACOB KAILOLAAnalisis Tingkat Social Ekonomi Masyarakat Dalam Pengelolaan Hutan Rakyat Berbasis Social Forestry di Kecamatan Kao Kabupaten Halmahera Utara3406BaruStatus usulan:1229017501POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:ALFRED LABIPengaruh Partisipasi Anggaran Terhadap Kinerja Staf dan Dosen Yang Dimoderasi Oleh Komitmen Organisasi Pada Politeknik Perdamaian Halmahera Tobelo3407BaruStatus usulan:1226087201POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:426

NONAMA KETUA PELAKSANAJUDULPERGURUAN TINGGISKEMAZETH PATTY SP, M.ScAnalisa Biaya dan Pendapatan Usaha Kayu Kelapa pada CV. Construction System Saro (CSS) di Tobelo Halmahera Utara3408BaruStatus usulan:0023117201POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:ARIANCE YEANE KASTANJA SP..,M.ScEvaluasi Penggunaan Herbisida dan Dominansi Gulma pada Lahan Jagung Manis di Kecamatan Tobelo Halmahera Utara3409BaruStatus usulan:0014017602POLITEKNIK PERDAMAIAN HALMAHERA125003Penelitian Dosen PemulaKode:Direktur Penelitian dan Pengabdian kepada Masyarakat,Agus SubektiNIP. 19600801 198403 1 002Jakarta, Maret 2014ttd427

Dokumen Terkait

Belajar Sablon Manual Pdf Dvfseempdffileswordpresscom

Belajar Sablon Manual Pdf Dvfseempdffileswordpresscom

Belajar sablon manual pdf belajar sablon manual pdf belajar.

Contoh Proposal / 7 kali tayang / 78KB

Penghargaan Efisiensi Energi Nasional 2013

Penghargaan Efisiensi Energi Nasional 2013

Indonesia sehingga dapat dijadikan contoh dan dapat direplik.

Contoh Proposal / 12 kali tayang / 1,250KB

Daftar Emoticon Facebook Terbaru Asset 8soupio

Daftar Emoticon Facebook Terbaru Asset 8soupio

Daftar harga laptop samsung terbaru agustus 2013 berikut ini.

Contoh Proposal / 9 kali tayang / 48KB

Mainstreet Dining And Entertainment Gandaria City

Mainstreet Dining And Entertainment Gandaria City

Adalah crystal jade restaurant yang menyajikan variasi masak.

Contoh Proposal / 9 kali tayang / 52KB

Outsourcing Sistem Informasi

Outsourcing Sistem Informasi

Landasan teori sistem informasi di perusahaan menurut obrien.

Contoh Proposal / 13 kali tayang / 269KB

Pengaruh Iklim Organisasi Etos Kerja Dan Disiplin Kerja

Pengaruh Iklim Organisasi Etos Kerja Dan Disiplin Kerja

Tujuan pembangunan kesehatan surakarta merupakan sebuah inst.

Contoh Proposal / 19 kali tayang / 292KB